KEGG   Xanthomonas citri pv. citri 306: XAC3074Help
Entry
XAC3074           CDS       T00084                                 

Gene name
nahA
Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    XAC3074 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XAC3074 (nahA)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     XAC3074 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3598474..3601005
Genome map
AA seq 843 aa AA seqDB search
MRQSLRLPTRLCYCAWLPCTAATSGSDCMMSNSAPTARLTAVSPLSSRLLALAFAAASLA
GCGQRAPGTSPAVATAGAPAAAANTAGIALPLIPAAVEVKRGSGSFTVGAGTVISIVPGD
ADARRSAEHLADLLQRTRGLRLEVRAETSASPGSIRLERSAQAPVGHKEGYSLEADAKGV
RIAARDGAGLLYGAISAWQLMTPDARKGEVQVPAVAIRDWPRFSWRGQHLDVARHFHDVD
TVKHVLDTMALHKLNVLHWHLTDDQGWRIEIKRYPKLTEVGAWRTPPGAGQHGTPQRYGG
FYTQEQISEIVAYAARLHITVLPELDMPGHAQAAVAAYPEEVGVPGARTQVGVDWGVNPY
LFNTSERSLTFITNVLDEVLTLFPSTYIHIGGDEAVKDQWEASPAVRAQMRKLGVKDAHA
MQGWFNEQLAAYLTQYGRRMIGWDEILEGGVPASASVMSWRGIEGAVTAAQQGHDVVLAP
GDWLYLDNLQTTRSDEPNGRLTVLPLSKVYAFDPVPAELSAEQAGHVLGAQGALWSEYIP
SRWHVDHALFPRLAAVAEVTWSPPAARNWNSFLTRMPAQLQRYKALGIDYSDGAFAADIA
LEGGPNPVLAGGPAKVALSTQAGAGTLHYTVDGSEPTPASPRYNAPFTIRLPTTVKATAF
DANGTPLAATRRRSFDRASLLRVDTQGLQHCVETGALGLRLPLLPEMTGADTPVYNVDLF
RACRLYPQARLDGIGAIRIEAARLPNNFGLAHEQSKVVQYPAKTRGGELEVRQGCDGELI
ASVQLPRSDTLGEQFTLETALPARTGVHDLCLRFTAPIRGPLYAIGAVQLIETTAQAPPA
ATR
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccagtcactgcgtcttccgacacggctttgctactgtgcgtggctgccgtgtacc
gccgccacatcgggatctgattgcatgatgtcgaactccgcacccaccgcacgcctgaca
gccgtctcgccgttatcctcgcgcctgcttgcgctcgcattcgcggcagcgtcgctggcc
ggttgcggtcaacgagcgccaggcacctcgccggccgttgcaaccgcgggcgcacctgct
gcagccgcaaacactgcgggtatcgcgttgccgctgattcctgcggcagtggaggtcaaa
cgcggtagcggcagcttcacggtgggcgccggcacggtgatctcgatcgtgcccggcgat
gccgatgcacgccgcagtgccgaacatctggccgatctgctgcaacgcacacgcgggctg
cggttggaagtgcgcgccgaaaccagtgcctcgccgggcagcatccgcctggagcgcagc
gcgcaggcgccggtagggcataaagaaggttacagcctggaagccgatgccaagggcgtg
cgcatcgccgcgcgcgatggcgccggcttgttgtatggcgcaatcagcgcctggcaattg
atgacaccggatgcgcgcaagggcgaggtccaggtcccggcggtggcgatccgcgactgg
ccgcgtttcagctggcgcggccagcacctggatgtggcccggcatttccatgatgtggac
acggtcaagcatgtgctcgatacgatggccctgcacaagctcaacgtgctgcattggcat
ctcaccgatgatcagggttggcgtatcgagatcaagcgctatcccaagctcaccgaggtg
ggcgcatggcgcacaccgcccggcgccggccagcacggcacgccacagcggtatggcggc
ttctacacccaggaacagatcagcgagatcgtcgcctatgcggcgcgtctgcacatcacc
gtgctgcccgaactggacatgcccggccatgcacaggcagccgttgctgcctaccccgaa
gaagtgggcgtacccggcgcacgcacgcaggtgggcgtggattggggcgtcaacccgtat
ctgttcaacaccagcgaacgcagcctgaccttcatcaccaatgtactggacgaggtgctg
accttgttcccgtcgacctacatccacatcggtggcgatgaggcggtgaaggatcagtgg
gaagcctcgccggcggtgcgcgcgcagatgcgcaagctcggggtcaaggacgcgcacgcg
atgcagggctggttcaacgaacaactggcggcctacctcacccagtacggccggcgcatg
atcggttgggatgaaattctcgaaggcggcgtgccggcgagtgcgtcggtgatgtcgtgg
cgcggcatcgaaggcgcagtgaccgcagcacagcaaggccacgatgtggtgctggcgccg
ggcgactggctgtatctggacaacctgcagaccacccgcagcgacgaaccgaacggccgc
ctgacggtgttgccgctgtcgaaggtctacgcattcgacccggtgccggccgagctcagc
gccgaacaggccgggcatgtactgggcgcacaaggcgcgttgtggtccgaatacatcccc
tcgcgctggcacgtggatcacgcactgtttccgcgtcttgctgcggtagcggaagtgacc
tggtcaccgccggcagcgcgcaactggaacagcttcctgacgcgcatgccggcgcagctg
cagcgctacaaggcgctgggcatcgactacagcgatggcgcattcgctgccgatatcgcc
ctggaaggcggacccaatccggtgctcgccggtgggccggccaaggtagcgctgagcacg
caagccggcgcgggcacgcttcactacaccgtcgacggcagcgagccaacgccggcatcg
ccgcgctacaacgcgccgtttacgattcgattgccgacgacggtcaaggcgactgcgttc
gatgccaacggaacgccgctggcggccacgcgtcgccgcagcttcgatcgcgcgagtttg
ttgcgggtggatacgcagggattgcagcactgcgttgaaaccggcgcgctcggcttgcgc
ctgccgctgttgccggagatgaccggcgccgacacgccggtgtacaacgtcgacctgttc
cgtgcctgccgcctgtatccgcaggcacggctggacggtatcggcgcaatccgcatcgaa
gccgcacgcttgcccaacaacttcggactggcgcacgagcaatccaaggtcgtgcaatac
ccagccaaaacccgcggcggtgagctggaagtgcgtcagggctgcgacggcgagttgatc
gccagcgtgcagctgccgcgcagcgacaccctgggcgagcaattcaccctggaaaccgca
ctgcctgcacgcaccggcgtccacgatctgtgcctgcgcttcaccgcgccgattcgcggc
cccctgtacgccatcggcgccgttcaattgattgaaaccactgcgcaggcgccccccgcc
gccacgcgctga

DBGET integrated database retrieval system