KEGG   Xanthomonas citri pv. citri 306: XAC3084Help
Entry
XAC3084           CDS       T00084                                 

Gene name
bga
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XAC3084 (bga)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XAC3084 (bga)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3620253..3622094
Genome map
AA seq 613 aa AA seqDB search
MLRTTLAPLVLALAFALPITGTAAETERWPNFGTQGTQFVRDGKPYQLLSGAIHFQRIPR
AYWKDRLQKARALGLNTVETYVFWNLVEPQQGQFDFSGHNDVAAFVREAAAQGLNVILRP
GPYACAEWEAGGYPAWLFGKGNIRVRSRDPRFLAASQAYLDALANQVQPLLNHNGGPIIA
VQVENEYGSYADDHAYMADNRAMYVKAGFDKALLFTSDGADMLANGTLPDTLAVVNFAPG
EAKSAFDKLIKFRPDQPRMVGEYWAGWFDHWGKPHAATDARQQAEEFEWILRQGHSANLY
MFIGGTSFGFMNGANFQNNPSDHYAPQTTSYDYDAILDEAGHPTPKFALMRDAIARVTGV
QPPALPAPIATTTLPDTPLRESASLWDNLPAPIAIDTPQPMEQFGQDYGYILYRTTVTGP
RKGPLYLGDVRDVARVYVDQRPVGSVERRLQQVSLDVEIPAGQHTLDVLVENSGRINYGT
RMADGRAGLVDPVVLDNRQLTGWQAFPLPMRTPDSIRGWTRKAVQGPAFHRGTLRIGTPT
DTYLDMRAFGKGFAWANGVNLGRHWNIGPQTALYFPAPFQRKGDNTVVVFDLDDVATPSV
RGLKQQVWLKPKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcaccacccttgcaccgctcgtcctggccctcgcgttcgcgcttcctatcacc
ggcacagccgcagagaccgaacgctggccgaacttcggcacgcagggcacgcagttcgtg
cgcgacggcaagccctatcaactgctttccggcgccatccatttccagcgcattccgcgc
gcctactggaaagaccgcctgcaaaaagcgcgtgcactgggcttgaacaccgtggaaacc
tacgtgttctggaatctggtggaaccgcagcaaggccagttcgatttttccggtcacaac
gatgtggccgcgttcgtgcgcgaagccgccgcgcaggggttgaacgtcatcctgcggccc
ggcccttatgcctgcgcagagtgggaagccggcggctacccggcctggttgttcggcaag
ggcaacatccgcgtccgcagccgcgacccgcgctttctcgccgccagccaggcgtatctg
gacgcactggccaaccaggtgcagccgctgctcaaccacaatggtgggccgatcatcgcc
gtgcaggtggagaacgaatacggctcttacgccgacgaccacgcgtacatggccgacaac
cgcgccatgtacgtcaaggccggcttcgacaaggccttgctgttcacctccgatggcgcc
gacatgctcgccaacggcaccttgcccgacaccctggcggtggtgaacttcgcacccggc
gaggccaagagcgcattcgacaaactgatcaagttccgccccgatcaaccgcgcatggtc
ggcgaatactgggccgggtggttcgaccattggggcaagccgcacgccgccaccgatgcc
aggcaacaggccgaggagttcgagtggatcctgcgccagggtcactcggccaatctctac
atgtttatcggcggcaccagtttcggcttcatgaatggcgccaatttccagaacaatccc
agtgaccactacgcgccgcagaccaccagctacgactacgacgccatcctcgacgaagcc
gggcaccctacgcccaagttcgcgttgatgcgcgatgccatcgcccgcgtgaccggcgtg
caaccgcccgcattaccggcgccgatcgcgaccaccacgctgccagacacgccgctgcgc
gaatcggcctcgctctgggacaacctgcccgcaccgatcgccatcgacaccccgcagccg
atggagcagttcggccaggattacggctacatcctctaccgcaccaccgtcaccggcccg
cgcaagggcccgctgtatctgggcgatgtgcgcgatgtggcgcgcgtgtacgtggatcaa
cgaccggtcggcagcgtcgaacggcgtttgcagcaggtgtccctcgatgtagagattcct
gcaggccagcacaccctggatgtcctggtcgaaaacagcggccgcatcaattacggcacg
cgcatggccgacggccgcgccggcctggtcgacccggtcgtgctggacaaccggcaactc
accggctggcaggccttcccgctgcccatgcgcacgcccgacagcatccgcggctggacc
cgcaaggccgtgcaaggcccggcgttccaccgcggcaccctgcgcatcggcacgccgacc
gacacctatctggacatgcgcgccttcggcaagggcttcgcctgggccaacggtgtcaac
ctgggccgccactggaatatcggcccgcagaccgcgctgtatttccccgcgccgttccag
cgcaagggtgacaacacggtggtggtcttcgatctggacgatgtcgccacccccagcgtg
cgcggcctgaagcagcaggtgtggctcaagccgaaggagtga

DBGET integrated database retrieval system