KEGG   Xanthomonas citri pv. citri 306: XAC3149Help
Entry
XAC3149           CDS       T00084                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XAC3149 (ruvA)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XAC3149 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3700184..3700768)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVSVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAVSEATVALQQLGYKPAEAARMARDAGAEGDE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtaggtggggtggggtatgagctagaggcgccgatgagcaccttctacgacctgcccgat
gtcggtcgcgacgtgatcctgtttacccattacgcgcaaaaggaagacagcgtgtcgctg
tatggcttcctgcgcgaaggcgagcggcggctgttccgcgacgtgcagaaggtcaccggc
atcggcgccaagatcgcgctggcggtgttgtccggggtcagcgtggacgagttcgcccgc
ctgatcaccagcggcgacatcaccgcgctgacgcgcattcccggcatcggcaagaagacc
gccgagcgcatggtggtggaactgcgcgaccgcgccgccgatttcagcagcggcgcaccg
attaccggccagttggggcccgacgccgtttccgaagccaccgtggccttgcaacagctg
ggctacaagccggccgaggccgcccgcatggcgcgcgacgccggtgcagaaggcgacgag
gtcgcgacggtcattcgcaaggcgctgcaggccgcgctgcgctaa

DBGET integrated database retrieval system