KEGG   Xanthomonas citri pv. citri 306: XAC3149Help
Entry
XAC3149           CDS       T00084                                 

Gene name
ruvA
Definition
(GenBank) holliday junction binding protein DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XAC3149 (ruvA)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     XAC3149 (ruvA)
DNA repair and recombination proteins [BR:xac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XAC3149 (ruvA)
    RecFOR pathway proteins
     XAC3149 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3700184..3700768)
Genome map
AA seq 194 aa AA seqDB search
MIGRLRGILAYKQPPWLVIDVGGVGYELEAPMSTFYDLPDVGRDVILFTHYAQKEDSVSL
YGFLREGERRLFRDVQKVTGIGAKIALAVLSGVSVDEFARLITSGDITALTRIPGIGKKT
AERMVVELRDRAADFSSGAPITGQLGPDAVSEATVALQQLGYKPAEAARMARDAGAEGDE
VATVIRKALQAALR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggccgtctgcgcgggatcctggcctacaagcagccgccgtggctggtgatcgac
gtaggtggggtggggtatgagctagaggcgccgatgagcaccttctacgacctgcccgat
gtcggtcgcgacgtgatcctgtttacccattacgcgcaaaaggaagacagcgtgtcgctg
tatggcttcctgcgcgaaggcgagcggcggctgttccgcgacgtgcagaaggtcaccggc
atcggcgccaagatcgcgctggcggtgttgtccggggtcagcgtggacgagttcgcccgc
ctgatcaccagcggcgacatcaccgcgctgacgcgcattcccggcatcggcaagaagacc
gccgagcgcatggtggtggaactgcgcgaccgcgccgccgatttcagcagcggcgcaccg
attaccggccagttggggcccgacgccgtttccgaagccaccgtggccttgcaacagctg
ggctacaagccggccgaggccgcccgcatggcgcgcgacgccggtgcagaaggcgacgag
gtcgcgacggtcattcgcaaggcgctgcaggccgcgctgcgctaa

DBGET integrated database retrieval system