KEGG   Xanthomonas citri pv. citri 306: XAC3438Help
Entry
XAC3438           CDS       T00084                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XAC3438 (pfkA)
   01230 Biosynthesis of amino acids
    XAC3438 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3438 (pfkA)
   00030 Pentose phosphate pathway
    XAC3438 (pfkA)
   00051 Fructose and mannose metabolism
    XAC3438 (pfkA)
   00052 Galactose metabolism
    XAC3438 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XAC3438 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    XAC3438 (pfkA)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XAC3438 (pfkA)
Protein phosphatases and associated proteins [BR:xac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XAC3438 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4048222..4049478
Genome map
AA seq 418 aa AA seqDB search
MTTGNLLYAQSGGVTAVINATAAGVIAEARARKIKVLAARNGILGALREELIDTSKESAA
AIAALAQTPGGAFGSCRYKLKSLEEDSAKYERLLDVLRAHDVRWFLYNGGNDSADTAWKV
SQLAKAYGYPLHCIGVPKTIDNDLAATDTCPGFGSAAKYTVVSVREAALDVAAMADTSTK
VFIYEAMGRHAGWLAAAAGLAGQGPDDAPQIILLPERAYDQAAFLAKVKQVVEKVGWCVV
VASEGIQDAHGKFVADAGGAADSFGHAQLGGVASFLAAQVKQELGYKVHWTLPDYLQRSA
RHLASKTDWEQAQAVGKAAVQYAIKGMNAVIPVIERVSDAPYRWKIVPAPLHKVANHEKK
MPPSFLRKDGFGITERARRYFAPLIKGEAALAYGSDGLPKYVSLKNVAVAKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaccactggcaacctgctctatgcccaatccggcggcgtcaccgccgtcatcaatgcc
actgccgccggcgtcatcgccgaagcgcgcgcacgcaagatcaaggtactggctgcgcgc
aatggcatcctgggcgccttgcgcgaggagttgatcgatacctccaaggaatccgctgca
gccattgccgcattggcgcagacccccggcggcgctttcggctcgtgccgctacaagctc
aaatcgctggaggaagacagcgccaagtacgaacgtctgctcgacgtgctgcgcgcgcac
gacgtgcgctggttcctctacaacggcggcaacgactcggccgacaccgcgtggaaggtc
tcgcaactcgcaaaggcctatggttacccgctgcactgcatcggcgtgccaaagaccatc
gacaacgatctggcggcgaccgacacctgccctggcttcggctcggcggccaagtacacc
gtcgtctcggtacgcgaggccgcactggatgtcgccgccatggccgacacctccaccaag
gtcttcatctatgaggcgatgggccgccatgccggttggctggccgcagcggcaggcctg
gccgggcaaggcccggacgacgccccgcagatcatcctgctacccgaacgcgcctacgac
caggctgcattcctggccaaggtgaaacaggtggtggagaaggtcggctggtgcgtggtg
gtggccagcgagggcatccaggacgcacacggcaagttcgtcgccgatgccggtggcgcg
gccgactcgttcggccatgcacagctcggcggcgtggcctcgttcctggccgcacaggtc
aagcaggaactcggctacaaggtgcactggacgttgccggattacctgcagcgctccgca
cgccacctcgcatccaagacggactgggaacaggcgcaagcggtcggcaaggccgccgtg
caatacgcgatcaaaggcatgaacgcggtgatcccggtgatcgaacgcgtcagcgacgca
ccctaccgctggaagatcgtgcccgcccccctgcacaaggtggccaatcacgaaaagaag
atgccgcccagcttcctgcgcaaggacggcttcggcatcaccgaacgcgcccgccgctac
ttcgccccgttgatcaagggcgaagccgcgctggcctacggcagcgatggcttgccgaag
tatgtgagtttgaagaatgtcgcggtggcgaagaaattgccagcttgggaggggtga

DBGET integrated database retrieval system