KEGG   Xanthomonas citri pv. citri 306: XAC3462Help
Entry
XAC3462           CDS       T00084                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     XAC3462 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4086873..4087529
Genome map
AA seq 218 aa AA seqDB search
MTIDFTQAREKMVEQQIRPWDVLDLRVLDVLARMPREAFVPEAYRTLAYVDVEIPLSAGH
KMMKPVVEGRMLQALDLQPGEDVLEVGTGSGFATACLAALAREVLSLEIDPALAAAARAN
LDRTGLGSNVRIETADVFGWQSERRFDAICVTGAVDTLPVQWLQWLRPNGRLFVVRGHDP
VMEAVLVRGDVNAPRIESLFETDLAYLQGAAPTPRFQF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatttcacccaggcccgcgaaaagatggtcgagcagcagatccggccgtgg
gacgtgctggacctgcgcgtactcgacgtgctggcgcgcatgccgcgcgaagccttcgtg
ccggaggcgtacaggacgctggcctatgtcgacgtggaaattccgctgtcggccggccac
aagatgatgaagccggtggtcgaaggccgcatgttgcaggcactggatctgcaaccaggc
gaggacgtcctggaagtcggcaccggcagcggctttgccaccgcctgcctggccgcactg
gcacgcgaagtcctcagcctggagatcgacccggcgctggccgcggccgcacgcgccaat
ctggaccgcaccggcctgggcagcaacgtccgcatcgaaaccgccgacgtcttcggctgg
cagagcgagcgtcgcttcgacgccatctgcgtgaccggtgcggtcgacacgctgcccgtc
cagtggctgcagtggttgcgcccgaacggccggctgttcgtcgtgcgcggtcacgatccg
gtgatggaagcggtcctggtccgtggcgacgtcaacgccccgcgcatcgaatcgttgttc
gaaaccgacctcgcctatctccagggcgccgcaccgacgccccgattccaattctga

DBGET integrated database retrieval system