KEGG   Xanthomonas citri pv. citri 306: XAC3494Help
Entry
XAC3494           CDS       T00084                                 

Gene name
aspC
Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00220  Arginine biosynthesis
xac00250  Alanine, aspartate and glutamate metabolism
xac00290  Valine, leucine and isoleucine biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01130  Biosynthesis of antibiotics
xac01210  2-Oxocarboxylic acid metabolism
xac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XAC3494 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    XAC3494 (aspC)
   00220 Arginine biosynthesis
    XAC3494 (aspC)
Enzymes [BR:xac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XAC3494 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     XAC3494 (aspC)
Amino acid related enzymes [BR:xac01007]
 Aminotransferase (transaminase)
  Class I
   XAC3494 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AAM38337
UniProt: Q8PGW8
Position
4131666..4132937
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIATAYARRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLSLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gaaatccggggcgagctggcgcgacgagcgcgggagctggaggcgcagggccgcaagctg
atcaagctcaatatcggtaacccgggtgcgttcggcttccgtgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccgtacacccatcagcaaggcctgccg
gaagcgcgcgaggcgatcgccaccgcatatgcgcggcgccagcatccggatgcgcatccg
gaccgcatcttcgttggcaacggcgtcagcgaactgatcgatctgtcgctgcgtgcgctg
ctcaatcccggcgacgaagtgctggtgccctcgcccgactatccgctgtggtcggccgcg
accatcctcaacgatggtcgtcccgtgtattaccgctgcgccccggaaaacggcttccag
ccggacccagtggagatcgagacgctggtgtcctcgcgcacccgcgccatcgtgctgatc
aatccaaacaatcccagcggcgccagttattcgcgcgaactgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctcttgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcgccgctggccggcgcgcacccgtgcatcactttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcactgctgtcg
ggcgaccaagcgcgcatcaacgacttgcgcaatgcgatggacctgctcggcgccttgcgc
ctgtgcgccaatgtaccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcattgtgcgcacccggcggacggctgtacgaaacccgccgcgcggtgatcgag
gcctgcgcggccagcgagcatctgtcgctggtggcaccggccggtgcgctgtatgcgttc
ccggcagtggtgggcgcggcggcgcgcaacttcgacgatcatgcgttcgccctcgatctg
atgaacgaggaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccat
catttccgcgtgacattgatgccggaagccggtgtgatgcgcgatgtgttcgcgcgcatc
gaccgtgcactggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system