KEGG   Xanthomonas citri pv. citri 306: XAC3494Help
Entry
XAC3494           CDS       T00084                                 

Gene name
aspC
Definition
aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    XAC3494 (aspC)
   01230 Biosynthesis of amino acids
    XAC3494 (aspC)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    XAC3494 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    XAC3494 (aspC)
Enzymes [BR:xac01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     XAC3494 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     XAC3494 (aspC)
Amino acid related enzymes [BR:xac01007]
 Aminotransferase (transaminase)
  Class I
   XAC3494 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4131666..4132937
Genome map
AA seq 423 aa AA seqDB search
MSTAPQKPLAIRERLSEVRYEIRGELARRARELEAQGRKLIKLNIGNPGAFGFRAPEHLQ
RAIADDMGRTDPYTHQQGLPEAREAIATAYARRQHPDAHPDRIFVGNGVSELIDLSLRAL
LNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCAPENGFQPDPVEIETLVSSRTRAIVLI
NPNNPSGASYSRELLERIVAIATKHNLLLMVDEIYDQVLYDDAAFVPVAPLAGAHPCITF
SGLSKVHRACGWRVGWALLSGDQARINDLRNAMDLLGALRLCANVPGQYAIDAAVNGPDT
ISALCAPGGRLYETRRAVIEACAASEHLSLVAPAGALYAFPAVVGAAARNFDDHAFALDL
MNEEGVLVVPGSSFNVPYRHHFRVTLMPEAGVMRDVFARIDRALARRAEAVTKVVPLKPR
SVA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgccccgcaaaagccgctcgccatccgcgagcgtctgtccgaagtccgctac
gaaatccggggcgagctggcgcgacgagcgcgggagctggaggcgcagggccgcaagctg
atcaagctcaatatcggtaacccgggtgcgttcggcttccgtgcgccggagcatctgcag
cgcgccatcgccgacgacatgggccgcaccgatccgtacacccatcagcaaggcctgccg
gaagcgcgcgaggcgatcgccaccgcatatgcgcggcgccagcatccggatgcgcatccg
gaccgcatcttcgttggcaacggcgtcagcgaactgatcgatctgtcgctgcgtgcgctg
ctcaatcccggcgacgaagtgctggtgccctcgcccgactatccgctgtggtcggccgcg
accatcctcaacgatggtcgtcccgtgtattaccgctgcgccccggaaaacggcttccag
ccggacccagtggagatcgagacgctggtgtcctcgcgcacccgcgccatcgtgctgatc
aatccaaacaatcccagcggcgccagttattcgcgcgaactgctggagcgcatcgtggcg
atcgccaccaagcacaatctgctcttgatggtcgatgagatctacgaccaggtgctgtac
gacgacgcggccttcgtgccggtcgcgccgctggccggcgcgcacccgtgcatcactttc
agcggcctgagcaaggtgcatcgcgcctgcggttggcgcgtgggctgggcactgctgtcg
ggcgaccaagcgcgcatcaacgacttgcgcaatgcgatggacctgctcggcgccttgcgc
ctgtgcgccaatgtaccaggccagtacgccatcgatgcggccgtgaacgggccggacacc
atctcggcattgtgcgcacccggcggacggctgtacgaaacccgccgcgcggtgatcgag
gcctgcgcggccagcgagcatctgtcgctggtggcaccggccggtgcgctgtatgcgttc
ccggcagtggtgggcgcggcggcgcgcaacttcgacgatcatgcgttcgccctcgatctg
atgaacgaggaaggcgtgctggtggttcccggctccagcttcaacgtgccgtatcgccat
catttccgcgtgacattgatgccggaagccggtgtgatgcgcgatgtgttcgcgcgcatc
gaccgtgcactggcacgccgcgccgaagcggtcaccaaggtggttccactcaagccacgc
agcgtggcctga

DBGET integrated database retrieval system