KEGG   Xanthomonas axonopodis pv. citri 306: XAC3516Help
Entry
XAC3516           CDS       T00084                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xac00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4156622..4157803)
Genome map
AA seq 393 aa AA seqDB search
MSAHAHTGGMTRRRLLHAGTLAGVAALLPAAALAAPSQCGPWPLWSAFVDKHIQRDGRVV
DFLNPDQRSTSEGQSYALFFALVNNDQVLFDKVLSWTRHNLCGGRPDLNLPAWLWGRDGS
GAWRVLDANTASDGELWIAYALLEAGRLWSRPGFLKAGQQMLQLIRTQEVATLPGLGPML
LPGRTGFVDNGRWTLNPSYLPIQVLRRCANADPKGPWAAIAANSARVLRDSAPVGFAPDW
TVWDGKTFNADPKRGNVGSYDAIRVYLWAGMLDAGEPLRARLLQDLSGPADLLAAQQTPA
EKIDTARGVGTGALPVGFSAALLPYLSALGKPALLKAQAQRVPAATQPAAAALPYFERTL
ALFGQGWLENRYRFAADGRLLPAWRTPACAATT
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgcacgcacataccggtggcatgacgcgccgtcgcctgctgcatgcaggcaca
ttggcgggcgtggccgcgctgctgccggcagccgcgctggcggcgcccagccagtgcggg
ccgtggccgctgtggagcgccttcgtcgacaagcacatccagcgcgatgggcgggtggtg
gattttctcaatcccgatcaacgctccacctcggaagggcagtcgtatgcgctgttcttc
gccctggtcaacaacgatcaggtgctgttcgacaaggtgctgagctggacccgccacaac
ctgtgcggcggccgcccggatctcaacctgccggcatggctgtggggccgcgatggcagc
ggcgcctggcgcgtgctggacgccaacaccgccagcgatggcgagttgtggattgcctat
gcgctgctggaagccggcaggttgtggagccgcccgggctttctcaaggccggccagcag
atgctgcagctgatccgcacgcaggaagtggccacgctgcccgggttgggcccgatgctg
ctgccgggccgcaccggcttcgtcgacaacgggcgctggacgctcaatcccagctatcta
cccatccaggtgctgcgtcgttgcgccaacgccgaccccaagggcccatgggccgccatc
gccgccaacagcgcgcgcgtgctgcgcgacagtgcgccggtggggtttgccccggattgg
acggtgtgggacggcaagaccttcaatgccgatcccaagcgcggcaatgtgggcagttac
gacgccatccgcgtgtacctgtgggccggcatgctggacgctggcgagccgctgcgcgcg
cggttgctgcaggacctgtccggaccggccgacctgctcgccgcgcagcagacgccggcc
gaaaagatcgacaccgcgcgtggtgtgggcaccggcgcgctgccggtgggattttctgcg
gcgttgttgccgtacctgagcgcgctgggcaagcccgcgctgctcaaggcgcaggcgcag
cgggtgcccgccgccacgcagccggccgccgctgccttgccgtatttcgaacgcacgctg
gccctgttcggacagggatggcttgagaaccgctaccgcttcgccgcagacgggcgcctg
ttgcccgcctggagaacccctgcatgcgccgcaacgacctga

DBGET integrated database retrieval system