KEGG   Xanthomonas citri pv. citri 306: XAC3516Help
Entry
XAC3516           CDS       T00084                                 

Definition
(GenBank) cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     XAC3516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4156622..4157776)
Genome map
AA seq 384 aa AA seqDB search
MTRRRLLHAGTLAGVAALLPAAALAAPSQCGPWPLWSAFVDKHIQRDGRVVDFLNPDQRS
TSEGQSYALFFALVNNDQVLFDKVLSWTRHNLCGGRPDLNLPAWLWGRDGSGAWRVLDAN
TASDGELWIAYALLEAGRLWSRPGFLKAGQQMLQLIRTQEVATLPGLGPMLLPGRTGFVD
NGRWTLNPSYLPIQVLRRCANADPKGPWAAIAANSARVLRDSAPVGFAPDWTVWDGKTFN
ADPKRGNVGSYDAIRVYLWAGMLDAGEPLRARLLQDLSGPADLLAAQQTPAEKIDTARGV
GTGALPVGFSAALLPYLSALGKPALLKAQAQRVPAATQPAAAALPYFERTLALFGQGWLE
NRYRFAADGRLLPAWRTPACAATT
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgccgtcgcctgctgcatgcaggcacattggcgggcgtggccgcgctgctgccg
gcagccgcgctggcggcgcccagccagtgcgggccgtggccgctgtggagcgccttcgtc
gacaagcacatccagcgcgatgggcgggtggtggattttctcaatcccgatcaacgctcc
acctcggaagggcagtcgtatgcgctgttcttcgccctggtcaacaacgatcaggtgctg
ttcgacaaggtgctgagctggacccgccacaacctgtgcggcggccgcccggatctcaac
ctgccggcatggctgtggggccgcgatggcagcggcgcctggcgcgtgctggacgccaac
accgccagcgatggcgagttgtggattgcctatgcgctgctggaagccggcaggttgtgg
agccgcccgggctttctcaaggccggccagcagatgctgcagctgatccgcacgcaggaa
gtggccacgctgcccgggttgggcccgatgctgctgccgggccgcaccggcttcgtcgac
aacgggcgctggacgctcaatcccagctatctacccatccaggtgctgcgtcgttgcgcc
aacgccgaccccaagggcccatgggccgccatcgccgccaacagcgcgcgcgtgctgcgc
gacagtgcgccggtggggtttgccccggattggacggtgtgggacggcaagaccttcaat
gccgatcccaagcgcggcaatgtgggcagttacgacgccatccgcgtgtacctgtgggcc
ggcatgctggacgctggcgagccgctgcgcgcgcggttgctgcaggacctgtccggaccg
gccgacctgctcgccgcgcagcagacgccggccgaaaagatcgacaccgcgcgtggtgtg
ggcaccggcgcgctgccggtgggattttctgcggcgttgttgccgtacctgagcgcgctg
ggcaagcccgcgctgctcaaggcgcaggcgcagcgggtgcccgccgccacgcagccggcc
gccgctgccttgccgtatttcgaacgcacgctggccctgttcggacagggatggcttgag
aaccgctaccgcttcgccgcagacgggcgcctgttgcccgcctggagaacccctgcatgc
gccgcaacgacctga

DBGET integrated database retrieval system