KEGG   Xanthomonas citri pv. citri 306: XAC3518Help
Entry
XAC3518           CDS       T00084                                 

Gene name
bcsA
Definition
(GenBank) celullose synthase
  KO
K00694  
cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    XAC3518 (bcsA)
Enzymes [BR:xac01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     XAC3518 (bcsA)
Glycosyltransferases [BR:xac01003]
 Polysaccharide
  Structural polysaccharide
   XAC3518 (bcsA)
Transporters [BR:xac02000]
 Other Transporters
  Others
   XAC3518 (bcsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4160172..4162361)
Genome map
AA seq 729 aa AA seqDB search
MPLVVPHAAMPEGRLMTAASRRSASPLPTLATWALWLLGALLLVFVVAVPMDVTQQLVFS
GVLFAVALAVRNRGGRVVILMMMGMSLAVSCRYIWWRMTQTMGVGSAVDFILGLGLLGAE
LYAFVILVLGYFQVLWPLNRKPVPLPADQRLWPSVDVFIPTYNEPLSVVRTTVLAASVID
WPAGKITIHLLDDGRRDEFRAFCAEVGINYVTRTNNAHAKAGNINAALKKCSGDYVAIFD
CDHIPTRSFLQVAMGWFLHDTKLALVQMPHYFFSPDPFERNLDTHGKVPNEGELFYGLLQ
DGNDQWNATFFCGSCAVIKRTALEEVGGVAVETVTEDAHTALKLQRRGYRTAYLAVPQAA
GLATESLSGHVAQRIRWARGMAQIARIDNPLLGRGLKLSQRLCYLNAMLHFFYGVPRIIY
LTAPLAYLFFGAHVIQASALMILAYALPHILQANLTNLRVQSRFRHLLWNEVYETTLAWY
IFRPTLVALLNPKLGKFNVTPKGGLVARSYFDAQIAKPYLFLLLLNVVGMVAGVLRLIYV
GGSGEQQTIWFNLAWTLYNMVLLGATIATASETRQVRSAHRVPLDVPVTLYLPDGDVLPS
RSVNFSTGGMAIMLAQPQPIEPGLPVQIGLSHRGVEQTLPAVVRQDRDGQVSIQFTQMSM
EQERWLVASTFARADIWLSQWGQHDRDAFWRSMGQVLEASARGFGRLGGHIVDSARQGFR
PRRAVDLES
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcttgttgtgccgcacgccgccatgcctgaaggacgattgatgaccgctgccagc
cgccgttccgcatcaccgctgcccacgctggcgacctgggcgctgtggttgctgggtgcg
ttgctgctggtgttcgtggtggccgtgccgatggatgtgacgcagcagctggtgttttcc
ggcgtgttgttcgcggtggcgttggcggtgcgcaaccgcggcgggcgggtggtcatcctg
atgatgatggggatgtcgctagcggtgtcgtgccgttacatctggtggcgcatgacccag
accatgggcgtgggcagcgcggtggatttcatcctcggcctgggcctgcttggcgccgag
ctgtatgccttcgtgatcctggtgctgggctatttccaggtgctgtggccgctcaaccgc
aagccggtgccgctgccggccgaccagcgcctgtggcccagcgtggacgtgttcatcccg
acctacaacgagccgctgtcggtggtgcgcaccaccgtgctggcggccagcgtgatcgat
tggccggccggcaagatcaccatccatttgctggacgacggccgtcgcgacgagtttcgc
gcgttctgcgccgaggtcggcatcaactacgtcacccgcaccaataacgcgcatgccaag
gccggcaacatcaatgccgcgttgaagaagtgcagcggcgattatgtggccatcttcgat
tgcgaccacattcccacccgcagttttctgcaggtggcgatgggctggttcctgcacgac
accaagctggcactggtgcagatgccgcactatttcttttcgccggacccgttcgaacgc
aacctggacacgcatggcaaggtgcccaacgaaggcgagttgttctacggcctgctgcag
gatggcaacgaccagtggaatgccacgttcttctgtggttcgtgtgcggtcatcaagcgc
accgcgctggaagaagtgggcggcgtggcggtggaaacggtcaccgaagatgcgcacacc
gcgctcaagctgcagcgccgcggttaccgcaccgcctacctggccgtgccgcaggccgcg
ggcctggccaccgaaagcctgtccggccacgtggcgcagcgcatccgctgggcgcgcggc
atggcgcagatcgcacgcatcgacaaccccttgctgggtcgcgggctcaaactgtcgcag
cggctgtgctacctcaacgcgatgctgcacttcttctacggcgtgccgcgcatcatctat
ctcactgcgccgctggcctatctgttcttcggcgcgcacgtgatccaggcctcggcgttg
atgatcctggcctacgccttgccgcatattttgcaggccaacctgaccaacctgcgcgtg
cagagccgcttccgccatctgctgtggaacgaggtctacgaaaccacgctggcctggtac
atcttccgtcccactctggtggccttgctcaatcccaaactcggcaagttcaacgtcacg
cccaagggggggctggtggcgcgcagctatttcgacgcgcagatcgccaaaccctatctg
ttcctgttgttgctcaacgtggtgggcatggtggccggtgtgctgcggctgatctatgtg
ggtggcagcggcgagcagcagaccatctggttcaacctggcctggacgctctacaacatg
gtgctgctgggcgccacgattgccaccgccagcgaaacgcgccaggtgcgcagcgcccac
cgtgtgccgctggatgtgccggtcaccctgtatctgcccgatggcgatgtgctgccgagt
cgctcggtgaatttttccacgggcggcatggcgatcatgctcgcgcagccgcagccgatc
gagcctggcttgccggtgcagatcggcctgagccatcgcggcgtggagcagaccttgccg
gcggtggtgcgccaggatcgcgatggacaggtcagcatccagttcacgcagatgtcgatg
gaacaggagcgctggctggtggcgtcgaccttcgcgcgcgccgacatctggctgtcgcag
tggggccagcacgaccgcgatgcgttctggcgctcgatggggcaggtgttggaagccagt
gcacgcggattcgggcgactgggcgggcatatcgtggacagcgcgcggcagggctttcgt
ccgaggcgcgcggtggatctggagtcgtga

DBGET integrated database retrieval system