KEGG   Xanthomonas citri pv. citri 306: XAC3558Help
Entry
XAC3558           CDS       T00084                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    XAC3558 (holC)
   00240 Pyrimidine metabolism
    XAC3558 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    XAC3558 (holC)
   03430 Mismatch repair
    XAC3558 (holC)
   03440 Homologous recombination
    XAC3558 (holC)
Enzymes [BR:xac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     XAC3558 (holC)
DNA replication proteins [BR:xac03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     XAC3558 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4216987..4217412
Genome map
AA seq 141 aa AA seqDB search
MPRADFYLIAKPRFLNEPLRLVCELARKANDANLSTLILARDAEQAEALDDLLWAFDDEA
YVPHQIAGTDEEDELAPVLIAAPEFAAPSRPLVINLRDDPYLGACDRVLEVVPADPAARE
PLRERWKQYKALGLELTKYDM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtgccgatttttatctgatcgccaagccgcgcttcctcaacgaaccgctgcgg
ctggtctgcgagctggcgcgcaaggccaacgacgccaacctgtccacgctgatcctggcc
cgcgatgcggagcaggccgaagcgctggacgatctgctgtgggcgttcgacgacgaggcc
tacgtgccgcaccagatcgccggcaccgacgaggaagacgaactggcaccggtgctgatc
gccgcaccggaattcgccgccccctcgcgcccgctggtgatcaacctgcgcgacgacccg
tacctgggcgcctgcgaccgcgtgctcgaagtcgtccccgccgaccccgctgcccgcgaa
ccgctgcgcgaacgctggaaacaatacaaggccctgggcctggaactgaccaagtacgac
atgtga

DBGET integrated database retrieval system