KEGG   Xanthomonas citri pv. citri 306: XAC3579Help
Entry
XAC3579           CDS       T00084                                 

Gene name
xanA
Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3579 (xanA)
   00030 Pentose phosphate pathway
    XAC3579 (xanA)
   00051 Fructose and mannose metabolism
    XAC3579 (xanA)
   00052 Galactose metabolism
    XAC3579 (xanA)
   00500 Starch and sucrose metabolism
    XAC3579 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC3579 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XAC3579 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC3579 (xanA)
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XAC3579 (xanA)
    5.4.2.8  phosphomannomutase
     XAC3579 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4244185..4245537
Genome map
AA seq 450 aa AA seqDB search
MPMTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALS
AGLRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISS
DTGLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGG
AGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDG
DFDRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVL
CKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLV
EARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGQWRFNLRSSNT
EPLLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgacgctacccgccttcaaggcctacgacattcgcggccgtgtgccggatgaa
ctcaacgaggacttggcccgccgcatcggcgtggcgctggcggcgcagctggatcaaggg
ccggtggtcctgggccatgacgtgcgcctggccagcccggcgctgcaggaagcgctgtcg
gccggcctgcgcgccagtggccgtgacgtgatcgacatcggcctgtgcggcaccgaggaa
gtctatttccagaccgattacctcaaggccgccggcggcgtgatggtgaccgccagtcac
aacccgatggactacaacgggatgaagctggtccgcgagcaagcgcgaccgatcagctcg
gacaccggactattcgccatccgcgacacggtcgcggccgataccgcagcgccaggcgag
cccaccgccagtgagcagagccgcaccgacaagaccgcgtatctggagcacctgctcagc
tacgtggaccgcagcacgctcaagccgctcaagctggtggtcaatgccggcaacggcggc
gccggtctgatcgtcgacctgcttgcgccgcatctgcctttcgagttcgtgcgcgtgttt
catgagcccgatggcaatttccccaacggcatccccaacccgttgctgccggaaaaccgc
gacgccaccgccaaggccgtcaaggacaatggcgccgatttcggtattgcgtgggacggc
gacttcgatcgctgtttcttcttcgatcacaccggccgcttcatcgaaggctattacctg
gttggccttctggcacaagccatccttgccaaacagccgggcggcaaggtcgtacacgac
ccgcgcctgacctggaacacggtcgagcaggtcgaagaagccggcggcattccggtgctg
tgcaagagcggccacgccttcatcaaggaaaagatgcgcagcgaaaatgccgtctacggc
ggcgagatgagcgcacaccactatttccgcgagttcgcctatgcagactccggcatgatt
ccgtggctgctgatcgccgagctggtgtcgcagtcgggccgttcgctggccgatctggtc
gaagcgcgcatgcagaaattcccctgcagcggcgagatcaacttcaaggtggccgatgcc
aaggcctccgttgcccgcgtgatggagcactacgcctcgctgtcgccggagttggactac
accgacggcatcagcgccgattttggccaatggcgtttcaacctgcgtagctccaacacc
gagccgctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgt
acgcaggaaatttctaacctgctgcgcggctga

DBGET integrated database retrieval system