KEGG   Xanthomonas citri pv. citri 306: XAC3579Help
Entry
XAC3579           CDS       T00084                                 

Gene name
xanA
Definition
(GenBank) phosphoglucomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac00010  Glycolysis / Gluconeogenesis
xac00030  Pentose phosphate pathway
xac00051  Fructose and mannose metabolism
xac00052  Galactose metabolism
xac00230  Purine metabolism
xac00500  Starch and sucrose metabolism
xac00520  Amino sugar and nucleotide sugar metabolism
xac00521  Streptomycin biosynthesis
xac01100  Metabolic pathways
xac01110  Biosynthesis of secondary metabolites
xac01120  Microbial metabolism in diverse environments
xac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3579 (xanA)
   00030 Pentose phosphate pathway
    XAC3579 (xanA)
   00051 Fructose and mannose metabolism
    XAC3579 (xanA)
   00052 Galactose metabolism
    XAC3579 (xanA)
   00500 Starch and sucrose metabolism
    XAC3579 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC3579 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    XAC3579 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC3579 (xanA)
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XAC3579 (xanA)
    5.4.2.8  phosphomannomutase
     XAC3579 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AAM38422
UniProt: Q8PGN7
Structure
PDB: 

Jmol
Position
4244185..4245537
Genome map
AA seq 450 aa AA seqDB search
MPMTLPAFKAYDIRGRVPDELNEDLARRIGVALAAQLDQGPVVLGHDVRLASPALQEALS
AGLRASGRDVIDIGLCGTEEVYFQTDYLKAAGGVMVTASHNPMDYNGMKLVREQARPISS
DTGLFAIRDTVAADTAAPGEPTASEQSRTDKTAYLEHLLSYVDRSTLKPLKLVVNAGNGG
AGLIVDLLAPHLPFEFVRVFHEPDGNFPNGIPNPLLPENRDATAKAVKDNGADFGIAWDG
DFDRCFFFDHTGRFIEGYYLVGLLAQAILAKQPGGKVVHDPRLTWNTVEQVEEAGGIPVL
CKSGHAFIKEKMRSENAVYGGEMSAHHYFREFAYADSGMIPWLLIAELVSQSGRSLADLV
EARMQKFPCSGEINFKVADAKASVARVMEHYASLSPELDYTDGISADFGQWRFNLRSSNT
EPLLRLNVETRGDAALLETRTQEISNLLRG
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ttgcccatgacgctacccgccttcaaggcctacgacattcgcggccgtgtgccggatgaa
ctcaacgaggacttggcccgccgcatcggcgtggcgctggcggcgcagctggatcaaggg
ccggtggtcctgggccatgacgtgcgcctggccagcccggcgctgcaggaagcgctgtcg
gccggcctgcgcgccagtggccgtgacgtgatcgacatcggcctgtgcggcaccgaggaa
gtctatttccagaccgattacctcaaggccgccggcggcgtgatggtgaccgccagtcac
aacccgatggactacaacgggatgaagctggtccgcgagcaagcgcgaccgatcagctcg
gacaccggactattcgccatccgcgacacggtcgcggccgataccgcagcgccaggcgag
cccaccgccagtgagcagagccgcaccgacaagaccgcgtatctggagcacctgctcagc
tacgtggaccgcagcacgctcaagccgctcaagctggtggtcaatgccggcaacggcggc
gccggtctgatcgtcgacctgcttgcgccgcatctgcctttcgagttcgtgcgcgtgttt
catgagcccgatggcaatttccccaacggcatccccaacccgttgctgccggaaaaccgc
gacgccaccgccaaggccgtcaaggacaatggcgccgatttcggtattgcgtgggacggc
gacttcgatcgctgtttcttcttcgatcacaccggccgcttcatcgaaggctattacctg
gttggccttctggcacaagccatccttgccaaacagccgggcggcaaggtcgtacacgac
ccgcgcctgacctggaacacggtcgagcaggtcgaagaagccggcggcattccggtgctg
tgcaagagcggccacgccttcatcaaggaaaagatgcgcagcgaaaatgccgtctacggc
ggcgagatgagcgcacaccactatttccgcgagttcgcctatgcagactccggcatgatt
ccgtggctgctgatcgccgagctggtgtcgcagtcgggccgttcgctggccgatctggtc
gaagcgcgcatgcagaaattcccctgcagcggcgagatcaacttcaaggtggccgatgcc
aaggcctccgttgcccgcgtgatggagcactacgcctcgctgtcgccggagttggactac
accgacggcatcagcgccgattttggccaatggcgtttcaacctgcgtagctccaacacc
gagccgctgctgcgcctgaacgtggaaacgcgcggcgatgccgcactgctggaaacgcgt
acgcaggaaatttctaacctgctgcgcggctga

DBGET integrated database retrieval system