KEGG   Xanthomonas citri pv. citri 306: XAC3878Help
Entry
XAC3878           CDS       T00084                                 

Definition
disulfide-isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xac  Xanthomonas citri pv. citri 306
Brite
Enzymes [BR:xac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XAC3878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4561794..4563374
Genome map
AA seq 526 aa AA seqDB search
MTLSLRRPSPSLIALLAVLAALAACNKPAPPAAPPQPKTASTPTAAAGIAWREGDVEDAF
AEAKDSGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGER
FGVKGYPTIIVLRSDHSEITRLAGDADNARLAEVLRVAAKSTSTAQQLLDKALHTPQQLS
ADDWAVLGNYAWGTDDRLVKPDDAADVLTRLSASAPQPALQRSFALAAISAAKHPPAASS
ANRTLLETVLADPAEVRANLGTLNYVPARLVTAASNEAGVRSALSNALNQALDKVYADPS
LPISDRLGTAYARIQLARLAQGQPTETEAEGPQPPLPKDVVEVVHQRVQWATDTAKTDEE
RQSTISTAAALLSEVGDRSAAEQLLLAELSRSKTPYYYMPELADLAEQRGDKKTALLWLK
RAYDSAQGPATRVQWGVMYVDGLIRLSPDDTAGIESAAAQVIGELAGQPDGYRQRTRQRF
TTLGTALKTWSKQHRREGSAVLARLQQKMQSSCNSKTTSECASWLS
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtcgctgcgacgcccttccccatccttgatcgcgctgctggcagtgctggct
gcgctggccgcctgcaacaaaccagcaccgcctgcggcgcccccacagcccaagacagcg
tccacgccgacagccgctgccggcatcgcctggcgcgagggcgatgtggaagacgctttt
gccgaagccaaggacagcggcaagccgatcctgttgtattggggcgcagcctggtgcccg
ccctgcaatcgcctcaaggccacgctgttcaaggatccggccttcatcgcgcgcacccag
caatttgtcgccgtgcacctggacggcgattccgaaggcgcgcaggcctggggcgagcgc
ttcggggtcaagggctatcccaccatcatcgtgctgcgctcggatcacagcgaaatcacc
cggctggcaggcgatgccgataacgcacgcctggctgaggtgttgcgggttgcggccaag
agcaccagcaccgcccagcaactgctcgacaaggcgctgcacacgccgcaacagctcagc
gcggacgactgggccgtgctcggcaactatgcctggggcaccgacgaccggctggtcaaa
cccgatgacgccgccgacgtgctcacccggctctcggcatcggcgccacagccggcactg
caacgcagcttcgccctggccgccatcagtgccgccaaacacccgccggctgccagcagc
gcaaatcgcacgctgctggaaacagtgttggccgacccggcagaagtgcgcgccaatctc
ggcacgctgaactatgtgccggcgcgcctggtcaccgccgccagcaatgaagccggcgtg
cgcagcgcgctctccaacgcactgaatcaggccttggacaaggtctacgccgatccttca
ttgccgatttccgaccggcttggcaccgcgtatgcgcgcatccagctggcacgcctggca
caaggccagcccaccgaaaccgaagccgaaggcccgcaaccgccgctgccgaaagacgtg
gtggaggtcgtgcaccagcgcgtgcagtgggccaccgacacggccaagaccgacgaggag
cgccaatccaccatcagcacggccgccgcgttgctgagcgaggtcggcgatcgcagcgcg
gcagagcaattgctgctggccgagttgtcgcgcagcaagaccccgtactactacatgccc
gagttggccgatctggccgaacaacgcggcgacaagaagaccgccctgttgtggctcaaa
cgggcctacgacagcgcgcagggccccgccacacgcgtgcagtggggcgtgatgtacgta
gatgggctgatccggctcagcccggacgatactgccggcatcgagagcgccgccgcccag
gtgattggcgagttggccggtcaaccggatggttaccggcaacgtacccgtcagcgcttc
accaccctcggcaccgcactgaagacctggagcaagcagcaccgccgcgaaggcagcgca
gtgctggcacgtctgcaacagaaaatgcagtccagctgcaacagcaaaactaccagcgag
tgcgccagttggctgagttga

DBGET integrated database retrieval system