KEGG   Xanthomonas axonopodis pv. citri 306: XAC3879Help
Entry
XAC3879           CDS       T00084                                 

Gene name
coxD
Definition
protoheme IX farnesyltransferase
Orthology
K02301  
protoheme IX farnesyltransferase [EC:2.5.1.-]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Oxidative phosphorylation
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:xac00190]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xac00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4563625..4564521)
Genome map
AA seq 298 aa AA seqDB search
MAVSARDYWDLTKPKVVALIVFTALVGMFLAIPDMPTWLQVRTGALGFLGIWLAASAAAA
INQLLDAKIDAQMARTSWRPLVVGKVRPWQVLVFAGVLIVISMTILVVWVNVITAVLTFA
SLIGYAVIYTVYLKRATSQNIVIGGLAGATPPMLGWAAVTGLPTSADWINASLLVLIIFI
WTPPHFWALAIFRRADYAKAAIPMLPVTHGVPHTRKQILVYTVLLAIVTLAPVAVGMSGM
FYLGGAAVLNAVFLWYAWRMLNPPDELFSMKMFGYSIVYLMALFAFLMVDHLLLPWVR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcagcgcacgcgattattgggatctgaccaaacccaaggtggtggcactgatc
gtgttcaccgccttggtggggatgttcctggctattcccgacatgccgacctggctgcag
gtgcgcaccggcgcgctgggcttcctgggcatctggctggccgcctcggcggcggcggcg
atcaaccaattgcttgatgccaagatcgacgcacagatggcgcgcacctcatggcgccca
ttggtggtgggcaaggtgcggccctggcaggtgctggtgttcgccggcgtgctgatcgtg
atctccatgaccattctggtggtgtgggtgaatgtcatcaccgccgtgctgaccttcgcc
tcgctgatcgggtatgcggtgatctacaccgtctacctgaagcgcgcgacctcccagaac
atcgtgatcggcggcctggccggcgccacgccgccgatgctgggctgggccgcggtgacc
gggctgccgaccagcgccgactggatcaatgcctcgttgctggtgctgatcatcttcatc
tggacgccgccgcatttctgggcgctggcaatctttcgtcgcgccgattacgccaaggcg
gccatcccgatgttgccggtaacccatggtgtgccgcatacgcgcaagcagatcctggtc
tacaccgtattgctggcgatcgtgaccttggcgccggtggcggtgggcatgagcgggatg
ttctacctgggcggcgcagccgtgctcaatgcggtgttcctctggtacgcgtggcgcatg
ctgaacccgccggacgaactgttttcgatgaagatgttcgggtactccatcgtgtacctg
atggcgttgttcgccttcctgatggtcgaccatctgctgctgccgtgggtgcgctag

DBGET integrated database retrieval system