KEGG   Xanthomonas axonopodis pv. citri 306: XAC3912Help
Entry
XAC3912           CDS       T00084                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XAC3912 (algC)
   00030 Pentose phosphate pathway
    XAC3912 (algC)
   00051 Fructose and mannose metabolism
    XAC3912 (algC)
   00052 Galactose metabolism
    XAC3912 (algC)
   00500 Starch and sucrose metabolism
    XAC3912 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    XAC3912 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    XAC3912 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XAC3912 (algC)
Enzymes [BR:xac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XAC3912 (algC)
    5.4.2.8  phosphomannomutase
     XAC3912 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4596687..4598081)
Genome map
AA seq 464 aa AA seqDB search
MQVAAGMFRAYDIRGVVGKDLNPGVAALIGQAIGSVMQAQGLRDVVVGRDGRLSGPELSN
GLIEGLRRAGCNVTDIGLAPTPVVYFGAYELRAGSCVAVTGSHNPPDYNGFKIVVGGETL
SGAAIAELHQRINEGRLHTAATPGELEQRDISDAYIQRIADDVQLDRPIKVVVDAGNGVA
GEIAPRLLEAIGADVVPLYCDIDGTFPNHHPDPSEPHNLNDLVKMVQRFDADIGVAFDGD
ADRLGVVTKEGAMVFPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGGSPLMW
KTGHSLIKSKMRETDAELAGEMSGHFFFKERWYGFDDGIYAAARLLEILAQREQTPSEVL
DALPESVSTPEIKVPVEGDAHALVAQFVARAQTGEESPFESARLSTIDGLRADFIDGWGL
VRASNTTPILVLRFEADSEAALQRIRTLFRNELQTLLPEHSVAF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggtcgccgccgggatgtttcgtgcctacgacatccgcggcgtggtcggcaaagac
ctcaaccccggcgttgccgccttgatcggccaggccatcggcagcgtgatgcaggcgcag
ggactacgcgatgtggtggtcggtcgcgacggccggctgtccgggccggagctgagcaac
ggcctgatcgaaggcctgcgccgtgccggctgcaacgtcaccgacatcggtctggcaccg
acgccggtggtgtacttcggcgcgtacgagctgcgtgccggcagctgcgtggcggtgacc
ggcagccacaatccaccggactacaatggcttcaagatcgtggtcggcggcgagaccttg
tccggcgccgccatcgccgaactgcaccagcgcatcaacgaaggccgcctgcataccgcc
gccacgcctggcgaactggaacagcgcgacatcagcgatgcctacatccagcgcatcgcc
gacgacgtccagctcgatcgcccgatcaaggtggtggtggacgccggcaatggcgtggcc
ggtgagatcgcaccgcgcctgctggaagcgatcggcgccgacgtggtgccgttgtactgc
gatatcgatggcaccttccccaaccatcaccctgatccgagcgagccgcacaacctcaac
gatctggtgaagatggtgcagcgtttcgatgccgatatcggcgtggcgttcgatggcgat
gccgatcgcctgggcgtggtgaccaaggaaggcgcgatggtgttccccgaccgcctgctg
atgctgttcgccgccgatgtactgcagcgcaaccctggcgcactggtcatctacgacgtg
aagtgcaccggcaagctgtccgactacgtattgcgcaacggcggcagtccgctgatgtgg
aagaccgggcattcgctgatcaagtccaagatgcgcgagaccgacgccgaactggctggc
gagatgagcggccacttcttcttcaaggagcgctggtacggctttgacgacggcatctac
gccgccgcacgcttgttggaaatcctggcccagcgcgagcagacgccgtccgaggtgctg
gacgccttgcctgaaagcgtctccacgccggagatcaaggtgccggtggaaggcgatgcg
catgcgctggtcgcgcaatttgtcgcgcgtgcgcagaccggcgaagaatcgccgttcgaa
tcggcgcggctgtcgaccatcgatggactacgtgcggacttcatcgacggctgggggctg
gtacgcgcctccaacaccaccccgatcctggtgctgcggttcgaagccgacagcgaagcc
gcattgcagcggattcgcacgctgttccgcaacgaactgcagacgttgttgccggagcat
tccgtggcgttctga

DBGET integrated database retrieval system