KEGG   Xanthomonas axonopodis pv. citri 306: XAC4166Help
Entry
XAC4166           CDS       T00084                                 

Gene name
phoD
Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xac00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:xac00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:xac02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4899533..4901161
Genome map
AA seq 542 aa AA seqDB search
MPVIDPPAASPLPDCAATLVPPDPSRRRILIAGASLAAAGLLSPFARASGSADPFTLGVA
AGDPLADGFVIWTRLAPRPLDPDGRGGLRAAVPVRWQVASDPQMRTIVRQGETIASPVWG
HAVHVELTGLMADRPYWYCFQALGARSPIGSARTLPAAHQTPDAARFGFVSCSHWELGYF
SAYRHLAAEQPDLVFFLGDYIYEYSNHGEATNKIVRPHGSGECLDLAGYRNRYALYRTDP
DLQALHAGSACAATWDDHEVQNDYANRWSQDPSIPVDTFLARRAAAYRAFYEHFPLRARH
RPHGADMRIYRSFDYGQLARFYVLDGRQYRSEQPCPQANGWRGGHVVADSCRERTDPRRT
MLGWEQERWLHGGFAQSPARWNVIAQDLLVAPMRQAGRDGVVGHWTDGWDGYPATRERML
DAIAKTRLRNPVFWGGDIHSYWVTDLKADPADDASATLATEFVGTSITSDGQSNDELHAT
MAANPHVHYVDGQTRGYVSVTLTPGRMETRLQGISDRRDRNATVSTTKRFVVEDGRPGAV
EA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgatcgacccgcctgccgcctcacccctgcctgattgcgctgccacgcttgtg
ccaccggatccgagccggcggcgcatcctcatcgccggcgccagcctggctgcggcgggg
ctgctgagcccgttcgcacgcgccagcggcagtgccgatcccttcacgctgggcgtggcg
gccggcgacccgttggccgatggctttgtgatctggacgcggctggcaccccgcccgctg
gacccggacggacgcggcggcctgcgcgcggcggtgccggtgcgctggcaggtggccagc
gacccgcagatgcgcaccatcgtgcgccagggcgagaccatcgccagccccgtctggggc
cacgcagtgcacgtggagctcaccggtttgatggccgatcgcccctactggtactgcttt
caggccctgggtgcacgcagcccgatcggcagcgcgcgcaccctgccggcagcgcatcag
acgccggacgcagcgcggttcgggtttgtttcctgctcgcactgggaactggggtatttc
agcgcctaccgccacctcgccgccgagcagccggacctggtgttcttcctgggcgattac
atctacgagtacagcaaccacggcgaggcgacgaacaagatcgtgcgcccgcacggcagc
ggcgaatgcctggatctggccggctaccgcaatcgctatgcgctgtaccgcaccgacccg
gacctgcaggcgctgcatgccggcagcgcctgcgcggcgacctgggacgatcacgaggta
cagaacgattacgccaatcgctggtcgcaggacccgtcgattccggtcgatacctttctg
gcccggcgcgctgccgcctaccgcgccttctacgaacatttcccgctgcgtgcgcggcat
cgcccgcacggcgcggacatgcgcatctaccgctcgttcgattacggccagctggcgcgt
ttctacgtgctcgatggccgccagtaccgcagcgagcaaccctgcccgcaggccaatggc
tggcgcggcggccatgtggtggccgacagttgccgcgagcgcaccgacccgcggcgcacc
atgctcggctgggaacaggagcgctggctgcatggcggcttcgcgcagtcgcccgcccgc
tggaacgtgattgcgcaggatctgctggtggcaccgatgcgacaggcggggcgcgacggc
gtggtcgggcactggaccgacggttgggacggctacccggccacgcgcgaacgcatgctc
gatgcgattgcaaagacgcgcctgcgcaacccggtgttctggggcggcgacatccactcg
tactgggtcaccgacctgaaggccgatccggccgacgacgcgtcggcaacgctggccacc
gaattcgtcggcacttcgatcacctccgacggccagagcaacgacgaactgcatgcgacc
atggcagccaacccgcacgtgcattacgtggacgggcaaacgcgcggctatgtgtcggtg
acgctcacgccgggccggatggaaacgcggctgcagggcatctccgatcggcgcgaccgc
aacgccacggtgtcgaccaccaagcgcttcgtggtggaggacggcaggcccggcgcagtg
gaggcgtga

DBGET integrated database retrieval system