KEGG   Xanthomonas citri pv. citri 306: XAC4167Help
Entry
XAC4167           CDS       T00084                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XAC4167
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    XAC4167
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XAC4167
Enzymes [BR:xac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XAC4167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4901334..4902905
Genome map
AA seq 523 aa AA seqDB search
MTASDPARRRVLQGLGAGVLLPATAGWPTRSLAAPSGRPTITDGVQSGDVLDDRAMLWSR
ADRPARLRVEWDTRPSLRQARRVDGTIASAAHDFTARADLSGLPRDQDIFYRVRFEDADS
GVLSAPVHGHLRSAPQARDDVRFVWSGDTVGQGFGINPDIGGMRIYSAMRERNPDFFLHS
GDTIYADSPIPAELTVEDGKRWRNLTTAAKSKVAETLDEFRGNYRYNLLDEHVRRFNAEV
SQLWQWDDHETTNNWSPGKQLDARYQVRDIDVLARRARQAFLEYAPMRGMRADGNGRIYR
KIAYGPLLDVFVLDMRSDRGANSDNLQPQPGPDAAFLGPEQLAWLQRELAGSRAQWKVIA
ADMPIGLQVPDGEDANGRPRWEAIANGDPGVPRGREQEIATLLRFISRARIRNTVWLTAD
VHYCAAHYYHPDRAAFQQFEPFWEFVGGPLNAGSFGPNALDATFGPSVVFQKAPPAPNTS
PLAGYQFFGEVDIDGRSGVLTVTLRDLDGVAQFRQPILPHGVT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctccgatcccgcccgtcgccgcgtcctgcaaggcttgggtgccggtgtgttg
ctgccggccactgccggttggcccacgcgcagcctggccgcgccgtcaggacgacccacc
atcaccgacggcgtgcagagcggcgatgtgctggacgaccgcgcgatgctgtggagccgt
gccgatcgcccggcgcggttgcgggtggaatgggacacgcgtccaagcctgcgtcaggcg
cggcgcgtggacggcacgatcgcgtcggcggcgcacgacttcaccgcacgtgcggacctg
agcggcctgccgcgcgaccaggacatcttctatcgcgtgcgcttcgaagatgccgacagc
ggcgtgttgagcgcgcccgtccacggccatctgcgcagtgcaccgcaggcgcgcgacgat
gtgcgctttgtctggagcggcgacacggtcggccagggcttcggcatcaacccggacatc
ggcggcatgcgtatctacagcgcgatgcgcgagcgcaatccggatttcttcctgcacagc
ggcgataccatctacgccgacagcccgatccccgccgagctgacggtggaagacggcaag
cgctggcgcaatctcaccacggcggccaaaagcaaggtggccgaaacgctggacgaattt
cgcggcaactatcgttacaacctgctcgatgagcacgtgcgccgcttcaacgcagaggtg
tcgcagctctggcaatgggacgaccatgaaaccaccaacaattggtcgcccggcaagcaa
ctggatgcgcgctaccaggtgcgcgacatcgacgtgctggccaggcgcgcccgccaggcc
ttcctggaatatgcgccgatgcgcggcatgcgcgccgatggcaacgggcgcatctaccgc
aagattgcctatggccccttgctggatgtgttcgtgctggacatgcgtagtgaccgcggc
gccaacagcgacaacctgcaaccgcagcccggccccgatgccgcgtttctcgggccggag
caattggcgtggttgcaacgcgaactggccggctcgcgtgcgcaatggaaggtgattgct
gccgacatgccgatcggcctgcaggtgcccgatggcgaagatgcgaacgggcgcccgcgc
tgggaagcgatcgccaatggcgaccccggcgtgccgcgtggccgcgaacaggaaatcgcc
acgctgttgcgcttcatcagccgcgcacgcatccgcaatacggtgtggctcaccgccgac
gtgcattactgcgcggcacactactaccaccccgatcgcgcagcgtttcagcagttcgaa
ccgttctgggaatttgtcggcggcccgctcaatgccggcagtttcgggcccaatgcactg
gatgccacgttcggcccgagcgtggtgtttcaaaaagcgccacctgcgcccaacacctcg
ccgctggccggctaccagttctttggcgaagtggacatcgacggccgcagcggcgtgctc
actgtgacgctgcgcgacctggatggggtggcgcagttccgtcaaccgattctgccgcac
ggggtgacgtag

DBGET integrated database retrieval system