KEGG   Xanthomonas axonopodis pv. citri 306: XAC4225Help
Entry
XAC4225           CDS       T00084                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:xac00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xac00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4984490..4985827
Genome map
AA seq 445 aa AA seqDB search
MSNTVYIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDVGDTALNRAEAKADAAFEFFTKLGVPYYCFHDIDLSPDADDI
TEYESNLKHMVGVAKQRQADTGIKLLWGTANLFSHPRYMNGASTNPDFNVVARAAVQVKA
AIDATVALGGENYVFWGGREGYACLHNTQMKREQDNMARFLTLARDYGRSIGFKGNFLIE
PKPMEPMKHQYDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDSGAGADFAAGKTTLADLAKHA
AGNAPQQISGRQEAYENLINQYLTR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccgtgtacatcggcgcgaaagaatatttccccggcatcggcaagatcggt
ttcgaaggccgcgattcggacaacccgctcgcgttcaaggtctacgacgccaacaagacc
atcggcgacaagaccatggccgagcatctgcgctttgccgtggcctactggcacagcttc
tgcggcaatggcgccgatccgttcggcccgggcacgcgtgcgtatccgtgggatgtgggc
gataccgcgttgaaccgtgccgaagccaaggccgatgcggcgttcgagttcttcaccaag
ctcggcgtgccgtactactgctttcacgacatcgacctgtcgccggatgccgatgacatc
actgagtacgagagcaacctcaagcacatggtgggcgttgccaagcagcgccaggccgac
accggcatcaagctgctgtggggcacggccaacctgttctcgcatccgcgctacatgaat
ggtgcctcgaccaacccggacttcaatgtcgtggcgcgtgcggcggtgcaggtcaaggcc
gcgatcgatgccacggtggcgctgggcggcgagaactacgtgttctggggcgggcgcgaa
ggctatgcctgcctgcacaacacgcagatgaagcgcgagcaggacaacatggcgcgcttc
ctcaccctggcgcgcgactacggccgcagcatcggcttcaaaggcaacttcctgatcgag
ccgaaacccatggagccgatgaagcaccagtacgattttgatagcgccacggtgatcggc
ttcctgcgtcagcatggcctggaccaggatttcaagctcaatatcgaagccaaccacgcc
acgctgtcgggccacagcttcgagcacgacctgcaggtggcatccgacgccggcctgctc
ggcagcatcgatgccaaccgcggcaatccgcagaacggctgggacaccgaccagttcccg
accgacctgtacgacaccgtcggcgccatgctggtggtgctgcggcagggcgggctggca
ccgggcggcttgaacttcgatgccaaggtgcgtcgcgaatcgtccgacccgcaggacctg
ttcctggcccacatcggcggcatggacgcgttcgcccgcgggctggaagtggccaacgcg
ctgctgaccgcctcgccgctggaacagtggcgcgccgagcgttacgccagcttcgacagc
ggcgcgggcgcggactttgccgcaggcaagaccacattggcggatctggccaagcatgcg
gccggcaatgcgccccagcagatcagcggccgccaggaagcgtatgaaaacctgatcaat
cagtatctgacgcgttga

DBGET integrated database retrieval system