KEGG   Xanthomonas citri pv. citri 306: XAC4250Help
Entry
XAC4250           CDS       T00084                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xac00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    XAC4250
  Lipid metabolism
   00600 Sphingolipid metabolism
    XAC4250
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    XAC4250
Enzymes [BR:xac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     XAC4250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5014911..5017466)
Genome map
AA seq 851 aa AA seqDB search
MRPQVVRSDDGKVADAQPEQAQLTDASAVRVLKPWILPTANGLIADPAQRHTRPPGNPGS
TVAYVQPHFDDSAWETVDLPHDWAIAGPFLANGPYGGMGRLPSWGIGWYRKSLDIPASDR
GRALFLDLDGAMSYATVWLNGTLVGGWPYGYSSWRVDLTPYVIAGKRNQLVIRLDNPPES
ARWYPGGGLYRNVWLTKTAPLHIAHWGTQLTTPHVSADAAQVQLTVTLDNAARSATQAQV
STAIYLLDDASDRPSGEAVARIPAQPIAVPAGGTAHVQGSTRIDAPRLWGPPPTQQPHRY
VAITEVGQQGHVVDRYETRFGIRSIVFDADRGLLVNGEHVPIRGVNNHHDLGALGAAFNR
RAAERQLQLLQQMGANAIRMSHNPPAPELLELTDRMGLLVVDEVFDSWEMKKTPLDFHLV
FPQWHATDLRAMLRRDRNHPSVMLWSVGNEVGEQYTGEQGAAIARALRAIVHAEDPTRPA
AVAMNYASPEMPLSAALDVVSLNYQGEGIRDAAEFEGTQRIRKPPQYPAFHARFPHKAIV
SSETASALSSRGVYLFPVTPDNSAPVRDGRGGDSAAHQVSAYELHAVDFGSSADKVFAAL
DRHPYVAGEFVWTGFDYLGEPTPYYSSRSSYSGIFDLAGFPKDRYWLYQSRWRPELPVAH
LLPHWSWPGREGQVTPVHVFTSGDEAELFVNGVSQGRKRKAPLQYRLRWDAVVYQPGELQ
MQAYKDGKPWASERVQTAGRAARMQLMPDRGSIRGDGQDLSFITVRLLDRDGRPAPTAGD
RLRFRIEGPGELVATDNGDPTNLETFASSQRHAFNGLCLAIVRAKAGARGTITVHVESDT
LQAAQTQVAVQ
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccgcaggtggtgcgcagcgatgacggcaaggtggccgatgcgcaaccggagcaa
gcgcagctcaccgatgcgtccgccgtgcgcgtgctcaagccgtggatcctgcccaccgcc
aacggcttgatcgcagacccggcccagcggcacacgcgccccccaggcaacccgggcagc
acggtggcttatgtgcagccgcacttcgacgacagcgcatgggaaaccgtggacctgcca
catgactgggccattgccgggccgttcctggcaaatgggccttacggtggcatgggccgg
ttgccgagctggggcattggctggtatcgcaagagcctggacatcccagccagcgatcgc
ggccgcgcgttgtttctggatctcgatggtgcgatgtcttacgccacggtctggctcaac
ggcacccttgtcggcggatggccttacgggtacagctcctggcgcgtggatctgacgccg
tatgtgattgcaggtaagcgcaatcaactggtcattcgcctggacaacccgcccgaatcg
gcgcgttggtatccgggcggcgggctgtatcgcaacgtgtggctgaccaaaacggcgccg
ttgcatatcgcgcattggggcacgcagctgaccacgccgcacgtttcggccgatgcggcg
caggtgcagctgaccgtcacgctggacaacgccgcccgcagcgccacccaggcgcaggtg
agcacagcgatctatctgctcgacgatgcaagcgaccggcccagcggcgaggcggtcgcg
cgcattccagcgcagcccatcgcggtccctgccggcggcaccgcgcacgtgcaaggcagt
acccggatcgacgccccgcgcctgtgggggcctccacccacgcagcaaccgcatcgctat
gtggccatcaccgaggttggccagcaggggcacgtggtggaccgctacgaaacccgcttc
ggcattcgcagcatcgtgttcgacgccgacaggggcctactggtcaatggcgagcacgtg
ccgatccgcggggtgaacaatcatcacgacctgggcgcgctcggtgcggcgttcaacaga
cgcgccgccgagcggcagttgcaattgctgcagcagatgggcgccaatgccattcgcatg
agccataacccgcctgcgcccgagttgctcgagctgaccgaccgcatgggcctgctggtg
gtggatgaggtgttcgacagttgggagatgaagaagaccccgctggatttccatctggtg
tttccgcagtggcatgccaccgatctgcgcgcgatgctgcgccgcgaccgcaatcatcct
tcggtgatgctatggagcgtgggcaacgaggttggcgagcaatacaccggcgaacagggc
gcggcgattgcgcgcgcgctgcgcgccatcgtgcatgcagaagacccgacgcgcccggcc
gcggtggcgatgaactacgcctcgcccgagatgccgttgtccgccgcgctggatgtcgtc
agcctcaattaccagggggaaggcatccgcgatgcagccgagttcgagggcacgcagcgc
atccgtaagccgccgcaatacccggcgtttcatgcacggtttccgcacaaggccatcgtc
agcagcgagactgcctcggcactgagcagtcgtggcgtgtatctgtttccggttactccg
gacaacagcgcgccggtacgcgatggccgtggcggcgattcggcggcgcatcaggtcagc
gcgtacgagctgcatgccgtggatttcggctccagtgccgacaaggtgttcgctgcgttg
gatcgacacccgtacgtcgccggcgagttcgtctggaccgggttcgattacctgggcgag
cccaccccgtattacagctcgcgcagttcctactcgggcatcttcgatctggccggcttt
ccgaaggaccgttactggctctatcaatcgcgctggcgcccggaattgccggtggcgcat
ctgctgccgcattggagctggccagggcgcgagggacaggtcacgcccgtgcatgtgttc
acctccggcgacgaggccgaactgttcgtcaatggcgtctcgcaggggcgcaagcgcaag
gcgccactgcagtaccggctacgctgggacgcggtggtgtaccagccgggcgaattgcag
atgcaggcgtacaaggatggcaagccgtgggccagcgagcgcgtgcagacagcaggccgc
gccgcgcgcatgcagctgatgccagatcggggcagtatccgcggcgacggacaggacctg
agtttcatcaccgtgcgcctgctcgatcgcgacggacgtcctgcgccgaccgcgggcgac
cgcctgcgcttccgcatcgaaggcccgggcgagttggtggccaccgacaacggcgatccc
accaatctggaaacattcgcctcttcgcagcgtcatgccttcaacgggctgtgcctggcg
atcgtgcgtgccaaggccggggcgcgtggcacgatcaccgtgcatgtggaatcggacacg
ttgcaagccgcacagacacaggtggcggtgcagtga

DBGET integrated database retrieval system