KEGG   Xanthomonas axonopodis pv. citri 306: XAC4296Help
Entry
XAC4296           CDS       T00084                                 

Definition
epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xac00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5077186..5079348)
Genome map
AA seq 720 aa AA seqDB search
MTLSRGALPFVLGLLPLAACADPAFDRCLAGLQTQAAAKGVDAASFQRFTAGLAPDSSVL
PLLDAQPEFTTPIWDYLASLVDSQRVTDGQAMLVTHRELLSRLSDQTGVDPATIVAVWGV
ESDYGRVTGKRPLLVSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLTGSWAGAFG
QTQFMPSTYARIAVDGDGDGRRDLVTSIPDALASTANYLVKAGWERARPWGMEVTLPRGF
DASKAGRTRRQPLQAWQSAGLLGTDGKPLAPTGLPAETPAALLLPAGATGPAFLVFRNYD
AIYAYNAAESYALSIALLADRLRGGAGLIAAWPTDDPGLGRPERRELQQLLLARGYQIGE
ADGMVGSATRRAIQVEQTRLGLQPADGRPGQRILAALRAAPPVAGAAAMRATAFKLPAAY
PAFAQSPSVQKASPMSDTTGLTTGDFHGFPSLLIDTPFSTAAISLFGGQLLSFVPEGGQD
VMWLSPSAQQPPTPIRGGAPVCWPYFGRQDQAGDVPAHGFVRTVAWQLTESHREDDGTVV
LTLTPPRFDDLALRLRMTLRIGRTLEQRLITENTSVAPVRFTQALHNYFRVGDALKVSVQ
GLDGLDYLDKYENYATAHRQQGDWSLRDPRDPGRSDRIYTNAGGRYTLTDPVLGRRIVIA
TEGSRSLVAWNPGEDAGKKMADVGEGWRDYVCLEAANAGPDVIELAPGASHTLTQTISVE
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgtcccggggcgcgttgccgttcgtgttgggactgctgccgctggcggcctgc
gccgatccggccttcgatcgctgcctggctggcctgcagacgcaggccgctgccaagggc
gtggacgctgccagctttcagcgcttcaccgccgggctggcgcccgattccagcgtcctg
ccgctgctggatgcgcagcccgaattcaccacgcccatctgggactacctggccagcctg
gtcgacagccagcgcgtcaccgatggccaggccatgctggtcacccaccgcgaactgctc
agccgcctgtccgatcaaaccggcgtggacccagccaccatcgtggcggtgtggggcgtg
gagagcgattacggccgcgtcaccggtaagcgcccgctgctggtatcgctggccacgctg
tcgtgcgcgggccgtcgccagccgttctttcgtggcgaattcctcgccttgctcagcctg
ctgcagcaaggcgatctgtcggcggacggcctcaccggctcctgggccggcgcgttcggg
cagacccagttcatgccttcgacctacgcccgcatcgcggtggatggcgacggcgacggc
cgccgcgatctggtgaccagcattcccgatgcactggcctccaccgccaactacctggtc
aaggccggctgggaacgcgcccgtccgtggggcatggaagtcaccctgccgcgcggtttc
gacgccagcaaggccgggcgcacccgccgccaaccgctgcaggcctggcaaagcgccggc
ctgctcggcaccgacggcaaaccgctggcaccaaccgggctgccggcagaaacgccggcc
gccttgctgctgccggccggcgccaccggcccggcgttcctggtgttccgcaactacgac
gcgatctacgcctacaacgccgccgaaagttacgcgctgtccatcgccctgctcgccgat
cgcctgcgtggcggcgcgggcctgatcgcggcctggcctaccgacgatcccggcctgggc
cggcccgaacgacgcgaactgcagcagttgctgctcgcccgcggctaccagatcggcgag
gccgacggcatggtcggcagcgccacccgccgcgccatccaggtcgagcagacccgcctg
ggcctgcaaccggccgacggccgtccgggccaacgcatcctcgccgcgttgcgcgccgcc
ccgccggtcgccggcgccgccgccatgcgcgccaccgcgttcaagctgccggccgcatac
ccggccttcgcccaatcccccagcgtccaaaaggcatcccccatgtccgacaccaccggc
ctgaccacaggcgatttccatgggtttccgtcgttgctgatcgacaccccgttctccacc
gccgccatcagcctgttcggtggccagctgctctcgttcgtgcccgagggcggacaggac
gtgatgtggctttcgcccagcgcccagcaaccgcctaccccgatccgcggcggtgcgccg
gtgtgctggccgtatttcggccgccaggaccaggccggcgacgttcccgcccacgggttc
gtgcgcacggtggcctggcaactcaccgaaagccaccgcgaagacgacggcaccgtggtg
ctcacgctcaccccgccgcgcttcgacgacctggcgctgcgcctgcgcatgaccctgcgc
atcggccgcacgctggagcaacgcctgatcactgaaaacaccagcgtcgccccggtgcgt
ttcacccaggcgttgcacaactacttccgtgtcggcgacgcgctcaaggtcagcgtgcag
ggcctggatggcctggactatctggataaatacgagaactacgccaccgcccaccgccag
caaggcgactggagcctgcgcgacccacgcgaccccggtcgtagcgaccgcatctacacc
aacgccggcggccgctacacgctcaccgacccggtgctcggtcgccgcatcgtcatcgcc
accgaaggcagccgctcgctggtggcctggaacccgggcgaagacgccggcaagaagatg
gccgacgtgggcgagggctggcgcgactacgtctgcctggaagcggccaatgccggcccg
gacgtcatcgagctcgcccccggcgccagccacaccctgacccagaccatcagcgtcgag
tag

DBGET integrated database retrieval system