KEGG   Xanthomonas axonopodis pv. citri 306: XAC4302Help
Entry
XAC4302           CDS       T00084                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
xac  Xanthomonas axonopodis pv. citri 306
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:xac00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5088199..5088813)
Genome map
AA seq 204 aa AA seqDB search
MNLRMSQSNQPDSPVTQTQAEEAVRTLLRWAGEDPTREGLLDTPRRVAEAYGDWFSGYRD
EPREYLERTFEEVAGYDELIVLRDISYESHCEHHMAPIIGKVHVGYLPRGKVVGISKLAR
VVESYARRFQVQEKMTAQIAQCIQDVLQPLGVGVVVEGAHECMTTRGIHKRGVSMVTSKM
LGSFREDARTRAEFLQFIEVGGKR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctgcgcatgagccagtccaaccagcccgattcccccgtgacccagacccaggcc
gaagaggccgtgcgcaccctgttgcgctgggcgggcgaagatcccacgcgtgagggcctg
ctggacacaccgcgccgggtggccgaagcctacggcgactggttcagcggctatcgggac
gaaccgcgcgaatacctggaacgcacgttcgaggaagtggccggctacgacgagttgatc
gtgctgcgcgacatttcctacgaaagccattgcgagcaccacatggcgccgatcatcggc
aaggtgcacgtgggctatctgccgcgtggcaaggtcgtcggcatcagcaagctggcgcgc
gtggtggaaagctatgcgcgccgcttccaggtgcaggaaaagatgaccgcgcagatcgcc
caatgcatccaggacgtgctgcagccgcttggcgtgggcgtggtggtggaaggcgcgcac
gagtgcatgaccacccgcggcatccacaagcgcggcgtcagcatggtgacctccaagatg
ctgggcagcttccgcgaggacgcgcgcacccgcgccgaattcctgcagttcatcgaagtg
ggcggcaagcgttga

DBGET integrated database retrieval system