KEGG   Xanthomonas citri pv. citri 306: XAC4335Help
Entry
XAC4335           CDS       T00084                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xac  Xanthomonas citri pv. citri 306
Pathway
xac03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XAC4335 (recD)
Enzymes [BR:xac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XAC4335 (recD)
DNA repair and recombination proteins [BR:xac03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XAC4335 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_19 AAA_30 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD AAA_22 UvrD-helicase UvrD_C T2SSE AAA_28 DEAD DUF2075 AAA_29 ATPase NTPase_1 AAA_16
Motif
Other DBs
NCBI-ProteinID: AAM39165
UniProt: Q8PEL4
Position
complement(5123886..5125943)
Genome map
AA seq 685 aa AA seqDB search
MSLLADLQAKSHLRTLDHAFAQSLRRLRPDTPDTVLLAAALASLAVANGHAGLDPRRPRL
LVDADVAWPAADAWMAQLQASPWIAQPDDPLAAAASDAPLVLEHGLLYLRRYREYEARLA
AGLTRIASDTLPATESAVLAAVFAALFPSATTGQDRQAQAAALALRRALLLITGGPGTGK
TTTIARLLLLRLAQAHAAGQPPPRIALAAPTGRAAERMAESLRIALARAIEQGLPAEHQG
ASPLPPAGEGARRAGEGTAPTDFSWHSALPTGASTLHRLLGVIPDSPHFRHDADNPLPFD
LIVVDEASMVDLPLMCKLVDAVADGTQLILLGDADQLPSVEAGDVLAAILRAAGPGDTLP
PDDARALQPLLGNAPVTAPAASTPVGHLAGHRVHLLRGYRQAADFALAPLADAVRIGDAE
TALSLLRSGTLPGVHFHEDGDDPLSLGREALLAHWQALTATNDPADALRQAGRLRLLTAV
RAGPQGARGLNARIEQLLAESGSGARRLGAASPWFHGRLLLITENSYRHGLFNGDVGICL
RSEASPASVRDPQAALVAWFEGDGDGQVRGFHPAALPAHESAFAMTVHKAQGSEFDEVWL
QLPTRDARVLSRELLYTGITRARRALHLAGSEAVIRSALARHAARISGLAWRLGAEQMQP
TADAASPLRATTPTALGNPIQGSLF
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgccgatctgcaggccaagagccatctgcgcacgctcgaccacgcgttc
gcgcagagcctgcgtcggttgcgtccggacacgcccgataccgtgctgctggccgctgcg
ctggcctcgctggccgtggccaatggccatgccggcctcgatccccgccgcccacggctg
ctggtcgatgcagacgtcgcctggccggcggccgacgcctggatggcccaactgcaggcc
tcgccgtggatcgcccaacccgacgatccgctggctgctgcggccagcgacgcacccctc
gtccttgagcacggcctgctctacttacgccgctatcgcgaatacgaagcccgcctggcc
gccgggttgacccgcatcgcgtcagacacgttgccagcgaccgagagtgctgtcctcgct
gcggtgtttgctgcgctgtttcccagcgcgaccaccggccaggatcgccaggcccaggcc
gccgcgctggcgctgcgccgcgccctgctgctgattaccggcggccccggcaccggcaag
accaccaccatcgcccgtctgctgctgctgcgtctcgcccaggctcatgccgccggccaa
ccgcccccccgcatcgcgctggccgcgcccaccggccgcgctgccgagcgcatggccgaa
agcctgcgcatcgcgctggcgcgcgcgatcgagcagggcttgcccgcagaacatcaaggc
gcgtcccctctcccgcctgcgggagagggtgcccgcagggcgggtgagggcaccgctcct
accgacttctcctggcacagcgccctgcccaccggcgccagcaccttgcatcgcctgctg
ggcgtgattccggattccccgcacttccgccacgacgccgacaacccgctgccgttcgac
ctgatcgtcgtcgacgaagcgtccatggtcgacctgccgctgatgtgcaagctggtcgat
gcggtggccgatggcacccaattgatcctgcttggcgatgccgaccaactgccctcggtg
gaagccggcgacgtactcgccgccatcctgcgggccgccggtcccggcgacacgctgccg
ccggacgatgcgcgcgcgctgcaacccttgttgggcaacgcgccggtgaccgccccagcc
gccagcacacccgtcggtcacctcgccggccaccgcgtgcacttactacgcggctaccgc
caggccgccgacttcgccctggcgccgctggccgatgccgttcgcattggcgatgccgag
accgcactgtcgctactgcgcagcggcacgctgccaggcgtgcacttccacgaagacggc
gatgacccattgagcctgggccgtgaggccttgctcgctcactggcaggcgctgaccgcg
accaacgatccggccgatgccctgcgccaggccggccgcctgcgcttgctcaccgcggtg
cgcgccggcccgcaaggcgcgcgcggcctcaacgcccgtatcgaacaactgttggccgaa
agtggctccggtgcccgccgcctcggtgcggcctcgccctggtttcacggccgcctgctg
ctgatcaccgaaaacagctatcgccatggcctgtttaacggtgacgtcggcatctgtctg
cgcagcgaagccagtcccgcctcggtgcgcgacccgcaagccgccctggtcgcctggttc
gaaggcgacggcgacggccaggtgcgcggcttccaccccgccgcactgcccgcacacgaa
agcgccttcgccatgaccgtgcacaaggcccaaggcagcgaattcgacgaggtctggctg
caactgcccacccgcgatgcccgcgtactcagccgcgaactgctctacaccggcatcacc
cgcgcccgccgcgccctgcacctggccggcagcgaagcggtcatccgtagcgcactggca
cgccacgccgcacgcatctcgggattggcatggcggctgggtgcggagcagatgcaaccc
actgcggatgctgcatcacctttgcgagcaacaacgccaaccgcattgggcaatcccatc
cagggctctctattctga

DBGET integrated database retrieval system