KEGG   Xanthomonas albilineans: XALC_0024Help
Entry
XALC_0024         CDS       T01160                                 

Gene name
recD
Definition
(GenBank) probable exodeoxyribonuclease v, alpha subunit protein
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
xal  Xanthomonas albilineans
Pathway
xal03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:xal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XALC_0024 (recD)
Enzymes [BR:xal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     XALC_0024 (recD)
DNA repair and recombination proteins [BR:xal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     XALC_0024 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD UvrD-helicase AAA_22 UvrD_C AAA_16 Herpes_Helicase T2SSE DUF2075 AAA_28 AAA DEAD AAA_24
Motif
Other DBs
NCBI-ProteinID: CBA14570
UniProt: D2U880
Position
complement(25368..27311)
Genome map
AA seq 647 aa AA seqDB search
MNLFDALQRAGTLRTLDLAFAQSLQRLDPTTAPAVLAAAALASLAVASGHAGLDPARANA
LLDSRDSTAPPLPTTDDWMRALAASRWVAQPVAEDAASADCPLVLERGLLYLRRYREYER
RLALGLRRLAAPSPPQGDLAALAPLFAQLFPRAGRQATLDDSFPDRQARAAALALRRALL
LVTGGPGTGKTTTIARLLLLRIAQSHTLSMPAPRIALAAPTGRAAERMAESLRAAVAHAC
ADGVDPALAEALPASASTLHRLLGVIRESPRFRHDPDNPLPFEVIVVDEASMVDLPLMCK
LVEAVADGAQLILLGDADQLPSVEAGDVLAAILQAAGPGDALQPADAHALRPLLGHSAVA
TQSGGLIGHRVQLLRSYRQAQDFTLAPLAEAVRTGEADTTMQLLRKGELAGVHFHDGVDD
PLVAGGDALFAHWRALGEAANPSEALHAAARLRLLTAVRAGPQGAHTLNARIEQRLAGPT
SGHRRLGSATPWFHGRLLLIVENSYRHGLFNGDVGICLRDAQGTLVAWFSGAGDGHVRGF
HPAALPAHESAFAMTVHKAQGSEFDTVWLQLPSRDARVISRELVYTGLTRARRALHLAAS
EPLLRAALARRAARISGLAWRLGGEPALSAHPESLIETGPPVQRGLF
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttcgatgccctgcaacgtgccggcacgctgcgcaccctcgacctggccttc
gcgcagagcctgcaacggctggacccgaccaccgcgccagcggtgctggccgctgccgct
ctggcctcgttggcggtggccagtggtcatgccgggttggacccggcccgcgccaacgcg
ttgctcgacagccgcgatagcaccgcgccgccgctgcccacaacggacgactggatgcgc
gcactggccgcctcgcgctgggtcgcccagccggtggccgaggacgccgcctccgccgat
tgcccactggtgctggaacgcggcctgctgtatctgcgccgctaccgcgagtacgaacga
cgcctggcccttggcctgcgccgcctcgccgcgccatcgccaccccagggcgacctggcc
gcgctggcgccgctgttcgcgcagttgtttccccgcgcagggcggcaggcaaccctggac
gattcctttcccgaccgtcaggcccgggccgccgcgctcgccctgcgccgcgcgctactg
ctggtcaccggcggccccgggaccggcaagaccaccaccatcgcccgcctgctgctactg
cgcatcgcccagtcgcacaccctgtccatgcccgcaccacgcatcgccctggccgcgccc
actggccgcgccgctgaacgcatggccgagagcctgcgtgctgccgtggcgcatgcgtgc
gccgatggcgtcgatccggccctggccgaagccttgccagccagcgcgagcaccttgcat
cgcctgctcggcgtcatccgcgaatcgccgcgcttccgccatgacccggacaacccactg
ccattcgaggtgatcgtggtggacgaagcctcgatggtcgatttgccactgatgtgcaag
ctggtcgaggccgtcgccgatggcgcacaactgatcctgctcggcgacgccgaccagttg
ccgtcggtggaagccggcgacgtgctcgccgcgatcctgcaagccgccggcccgggcgac
gccttgcagcccgccgacgcgcacgcgttgcggccgctgctcggccacagtgcagtggcc
acgcagagtgggggattgatcggacatcgcgtgcagttgctgcgcagctaccgccaggcg
caggactttactctagccccactggccgaggccgtgcgcacgggtgaggccgacaccacc
atgcagttgctgcgcaagggcgagttggccggtgtgcattttcacgacggtgtcgacgac
ccgctcgtcgccggcggcgacgccctgttcgcgcactggcgcgcgctgggcgaggccgcc
aaccccagcgaggcattgcacgccgccgcgcgcctgcgcctgctcactgccgtgcgcgcc
ggcccgcagggcgcgcacacgctcaacgcacgcatcgaacagcggctcgccggccccacc
agcggccaccgtcgcctggggagcgccacgccctggttccatggccgcctgctgttgatc
gtcgagaacagctaccggcacggcctgttcaacggcgatgtcgggatttgcttacgcgac
gcgcagggcaccttggtggcttggtttagcggtgctggcgacggccatgtgcgcggcttc
caccccgccgccttgcccgcgcacgagagcgccttcgccatgaccgtgcacaaggcccag
ggcagcgaattcgataccgtatggttgcaactgcccagccgcgacgcgcgcgtaatcagc
cgcgagctggtctacaccggcctcacccgcgcccgccgcgcgttgcatctggccgccagc
gaaccgctgctgcgcgccgcgttggcgcggcgcgcagcgcggatttccggattggcatgg
cggctgggtggggaaccggcattgtcagcacatcctgagtcgctgatcgaaacaggccca
ccagtgcagcgcggactgttctaa

DBGET integrated database retrieval system