KEGG   Xanthomonas albilineans: XALc_0033Help
Entry
XALc_0033         CDS       T01160                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xal  Xanthomonas albilineans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    XALc_0033
  Metabolism of other amino acids
   00480 Glutathione metabolism
    XALc_0033
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     XALc_0033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(39031..39573)
Genome map
AA seq 180 aa AA seqDB search
MSFSLYDIPLIRIDGQPTTLAEHRGKVLLIVNVASKCGLTPQYAGLEALYRDKRAAGLEV
LGFPANDFKGQEPGDEAQIQQFCQLTYDVTFPMFAKITVTGEATHPLYRALIQAQPQAEG
EGPMREKLAGYGIEPNPAPGVLWNFEKFLVGRDGQVCARFAPDVTADAPRLGAAIDAALS
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtctttctcgctctacgacatcccgctgatccgcatcgatggccaacccaccacgctc
gccgagcatcgcggcaaggtgctgctgatcgtcaacgtcgcttccaaatgcgggttgacc
ccgcagtacgccggcctggaagcgctgtaccgcgacaagcgcgccgccggcctggaagtc
ctcggcttcccggccaatgacttcaagggccaggaaccgggcgatgaagcgcagatccag
cagttctgccagctcacctacgacgtcacctttccgatgttcgccaagatcaccgtcacc
ggcgaggccacgcatccgttgtatcgcgcgttgatccaggcgcaaccgcaagccgaaggc
gaaggtccgatgcgcgagaaactggccggctacggcatcgaaccgaatccggcgccgggc
gtgctgtggaactttgaaaaattcctggtcgggcgtgatggtcaggtctgcgcgcgtttc
gcccccgatgtaaccgccgacgctccacgcctgggtgcggcgatcgacgcggcattgtca
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system