KEGG   Xanthomonas albilineans: XALc_0036Help
Entry
XALc_0036         CDS       T01160                                 

Definition
xylanase precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
xal  Xanthomonas albilineans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(43070..44053)
Genome map
AA seq 327 aa AA seqDB search
MKTIASLLFALLLISSTASVDAAPLAAGKKRFLGCAYSAPQMLDFGKYWNKLTSENGGKW
ASVEAVRGQMDWSEFDKAYNFAQDNNIIMFDHVMAWGSQQPEWMRTLPPAEQLAAIRHWF
AAVAERYPNIAMLEVANETLPNHNQPDNRYSDSGNYMQALGGPGVTGVDWVINLFRLARQ
YFPNTKLMINDYGITASDDATKQYLRTIQLLQRENLIDAIGLQEHAFETSSASWWTHFFN
LNTLGSTTGLPIYITEFDIDGPTDAQQLDGYKKFFPLFWENQYVKGVTLWGFRPGLWRDQ
EGAYLVNKDGSERPALKWLRDFVAITP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcgcatcgcttttatttgcattattgctgatctcttccaccgccagcgtc
gatgccgcaccgctagccgccggcaaaaaacgtttcctgggctgcgcctatagcgcgccg
cagatgctggatttcggcaagtactggaacaagctcacgtcagaaaacggcggcaagtgg
gccagcgtggaagcggtgcgcggacaaatggactggagtgagttcgataaagcttacaat
tttgcccaagacaacaacataataatgtttgaccatgtcatggcatggggtagccagcaa
ccggagtggatgcggacactgccaccggccgagcagctcgccgccatcagacattggttc
gccgcagtggccgagcgttaccccaatatcgccatgttggaagtcgccaacgaaacgttg
cccaatcacaatcaaccggacaatcgctacagcgacagcggcaactacatgcaagcactg
ggaggtcccggcgtcactggggtggattgggtcattaatttattccgcctggcccggcag
tatttcccgaataccaagctaatgatcaacgactacggcatcaccgccagcgacgacgcc
acgaaacagtatttgagaaccatccaattgttgcagcgtgaaaatctgatcgacgcgatc
ggcttgcaggagcatgccttcgaaacctcatcggcgtcctggtggacacatttcttcaac
ctcaacacgttgggctccaccacaggcttaccgatctacatcaccgagttcgacatcgac
ggcccgaccgatgcccagcagttggatggctacaagaaattctttccactgttctgggaa
aatcaatacgtaaagggcgtgacgctttggggcttccgccctggcctgtggcgcgaccag
gagggcgcctacttggtcaataaagacggcagcgaacgtccggcattaaaatggttgcgc
gatttcgtggcgattacaccataa

DBGET integrated database retrieval system