KEGG   Xanthomonas albilineans: XALC_0092Help
Entry
XALC_0092         CDS       T01160                                 

Gene name
acsA
Definition
(GenBank) probable acetyl-coenzyme a synthetase protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
xal  Xanthomonas albilineans
Pathway
xal00010  Glycolysis / Gluconeogenesis
xal00620  Pyruvate metabolism
xal00640  Propanoate metabolism
xal00680  Methane metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_0092 (acsA)
   00620 Pyruvate metabolism
    XALC_0092 (acsA)
   00640 Propanoate metabolism
    XALC_0092 (acsA)
  Energy metabolism
   00680 Methane metabolism
    XALC_0092 (acsA)
Enzymes [BR:xal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     XALC_0092 (acsA)
Lipid biosynthesis proteins [BR:xal01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   XALC_0092 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBA14638
UniProt: D2U8A1
Position
complement(123249..125192)
Genome map
AA seq 647 aa AA seqDB search
MADLYPVDPHVAARARVDKTQYQALYRQSVEQPEAFWGKVAERLDWFKAPTRIKDVNFAL
DDFRIRWFDDGELNASVNCLDRQLASRGDKTALLFEPDSPDVPSYRVSYRELYERVCRLG
NALRNLGVQKGDRVTIYLPMIPDAAVAMLACARIGAIHSVVFGGFAPNSIADRVIDCGSK
LIITADEGLRGGKKIPLKANVDAALKLPDTTSVETVLVVRHTGGAVNMQAPRDRWFHDVV
DNQPATCEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLYAAYTHESVFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATALMFEGVPNYPSVSRFWEVIDKHQVTLFYTAPTAI
RALMREGDAPVKKTSRKSLRLLGSVGEPINPEAWRWYYDVIGDGRCPIVDTWWQTETGGI
LITPLAGATDLKPGSATLPFFGVQPALVNTDGQILEGATEGNLVLRDSWPGQMRTVYGDH
QRFIDTYFRTYPGNYFTGDGCRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVAHPK
VAEAAVVGFPHDIKGQGIYAYVTLVADERPSDALHKELVAWVRKEIGPIATPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctctatcccgtcgatccacacgttgccgcccgcgcacgggtcgacaagacc
caataccaggctctgtatcggcaatcggtggaacagccggaggctttctggggcaaggtg
gccgagcgcctggactggttcaaggcgcccacccggatcaaggacgtgaacttcgccctg
gacgacttccgcatccgttggttcgacgacggcgagctcaacgccagcgtcaattgcctg
gatcggcaactggccagccgcggcgacaagaccgccctgttgttcgaacccgacagcccg
gacgtcccgtcctatcgggtcagctaccgcgaactgtacgaacgcgtctgccggctcggc
aacgcgctgcgcaacctcggcgtgcagaaaggcgaccgcgtcaccatctacctgccgatg
atccccgacgcggcggtggccatgctggcctgcgcgcgcatcggcgcgatccattcggtg
gtgttcggcggcttcgcccccaactccatcgccgaccgggtgatcgactgcggcagcaag
ctcatcatcactgccgatgagggcctgcgcggcggcaagaagatcccgctcaaggccaac
gtcgatgcggcactgaagctacccgacaccaccagcgtggagaccgtgctggtggtgcgc
cacacgggcggcgcggtgaacatgcaggccccgcgcgaccgctggttccacgacgtggtc
gacaaccaaccggccacctgcgaacccgagcgcatgaacgcggaagacccgctgttcatc
ctctacacctccggctccaccggcaaaccgaagggcgtgctgcacaccaccgccggctac
ctgctgtacgcggcctacacccacgagagcgtgttcgacctgcgcgaggacgacatctac
tggtgcaccgccgacgtcggctgggtcaccggccacagttacatcgtctacggaccactg
gccaacggcgccaccgcgctgatgttcgagggcgtgcccaattacccgagcgtgtcgcgt
ttctgggaggtcatcgacaagcatcaagtgacactcttctacaccgctccgactgcgatc
cgcgcactgatgcgcgaaggcgatgcgccggtgaaaaagacctcgcgcaagagcctgcgg
ctgctcggcagcgtcggcgaaccgatcaatcccgaagcatggcgctggtactacgacgta
atcggcgacggtcgctgcccgatcgtggatacctggtggcagaccgaaaccggcggcatc
ctgatcacgccactggccggcgccaccgacctcaagcccggttcggcgacactgccgttt
ttcggcgttcaacccgcccttgtcaacaccgacggtcagatcctggaaggcgccaccgag
ggcaacctggtgctgcgcgattcctggcctggacagatgcgcaccgtctatggcgaccac
cagcgcttcatcgacacctacttccgcacctatccgggcaactatttcaccggcgatggc
tgccgccgcgatgccgatggctactactggatcaccggccgcgtggacgatgtcatcaat
gtctccggccaccgcatcggcaccgccgaggtggaaagcgcgctggtcgcccaccccaaa
gtggccgaagcggcggtggtcggcttcccgcacgacatcaagggtcaggggatctacgcc
tatgtgaccctggttgcagacgaacgtcccagcgacgcactgcacaaagaactggtggcc
tgggtacgcaaggaaatcggcccgatcgccacgcccgaccacctgcaatgggcacccggc
ctgccgaagacgcgctcgggcaagatcatgcggcgcattctgcgcaagatcgccgagaac
gcacccgatcagctcggcgacacctccaccctggccgatccctcggtggtggactcgctg
gtcaacgaacgcctgacgcgctga

DBGET integrated database retrieval system