KEGG   Xanthomonas albilineans: XALc_0375Help
Entry
XALc_0375         CDS       T01160                                 

Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
xal  Xanthomonas albilineans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALc_0375
   00030 Pentose phosphate pathway
    XALc_0375
   00051 Fructose and mannose metabolism
    XALc_0375
   00052 Galactose metabolism
    XALc_0375
   00500 Starch and sucrose metabolism
    XALc_0375
   00520 Amino sugar and nucleotide sugar metabolism
    XALc_0375
  Nucleotide metabolism
   00230 Purine metabolism
    XALc_0375
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    XALc_0375
Enzymes [BR:xal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     XALc_0375
    5.4.2.8  phosphomannomutase
     XALc_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
423151..425460
Genome map
AA seq 769 aa AA seqDB search
MLTVLLFLLAGWFGWSAVRQWRAEQVTMTLERARDASVVRTTQVLEGAGKRLSECLQQPA
VQTALARGDAAAVVQALRGDWKQVEDAQLLPVDLESGYADPPRFGYGRLALLEKAVLTGK
VASGVVHDGGGVQLGLAAPVSLGERASVVYLRLPLGLLTDPVAQVTVPDSGYLALRQGSY
DVIAAGNSALSNRADALSRPLGDTGLRMVAALPDTEAGPFGLGAWPCLLVAVLLVVLRIL
LALAPRGYLSPRAGRAVAVTEEQTLQQSLQNQESLPPLPPSPPSPPSPPLSRSPAELTPA
MPVPASAVTADIFRAYDIRGVVGRDLNPQVAALIGQAIGTMMQEQGLNEVVVGRDGRLSG
PELAAALIDGLRRAGCAVIDIGVAPTPVVYFASYHLRAGSCVAVTGSHNPADYNGFKIVI
GGQTLSGAAIAELHACICEGRLSTAAEPGRLQQRDVGRDYVQRIADDVQLDRPLKVVVDA
GNGVGGELGPRLLEAIGAEVIPLYCDVDGTFPNHHPDPSDPHNLEDLVQTVRRFDADLGV
AFDGDADRLGVVTHDGKVIYPDRLLMLFAADVLQRNPGALVIYDVKCTGKLSDYVLRNGG
SPLMWKTGHSLIKAKMRETDAELAGEMSGHFFFKERWYGFDDGLYAAARLLEILAQREES
PSEVLAELPESIATPEIKVPLDGQDGHALIAQLAIQAQQEGSPFAGARLLTLDGVRADFP
DGWGLVRASNTTPALVLRFEADNATALERVKALFRAQLQTALPTAMLGF
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
ttgctgaccgttctgctgtttctgcttgccggatggttcggttggagcgctgtgaggcaa
tggcgtgccgagcaggtgaccatgacgctggaacgagcgcgcgatgcgtcggtggtgcgg
accacacaggtgctggagggagctggcaaacgcctgtccgaatgcttgcagcagccggct
gtgcagaccgcgctggcacgtggcgatgccgcagccgtcgtccaggccctgcgcggggat
tggaagcaggtcgaggatgcacaactgctgccggtggatctggaatccggctatgccgat
ccgccgcggttcggttacggtcgactggcgctgctggagaaagccgtgttgaccggaaag
gtcgccagcggcgtggttcatgatggtggcggtgtgcagttgggcttggcggcgccggta
tccttgggggagagggccagcgtggtctacctgcgcctgccgctgggcttgctcaccgac
ccagtcgcgcaggtgacggtgccggatagcggctacttggcgctgcgtcagggcagttac
gatgtgatcgctgccgggaattccgcgctgtccaatcgtgccgatgcgttgtcgcgccca
ctcggcgataccggtttgcgcatggtcgccgccttgcccgataccgaggctggaccattc
gggctgggcgcttggccgtgtctgctcgtcgccgtcctgctggtggtgttacgcatcttg
ctggcgctggccccacgcggatacttgtcgccgcgcgcaggtcgtgccgtggcggtgacc
gaagagcaaaccttgcagcagagtctgcaaaaccaggagtcgctgccaccgctgccgcca
tcgccgccatcgccgccatcgccgccattgtcacggtcgccagcggagctgacgccggcc
atgccggttcccgcgtctgccgtgacggccgatattttccgcgcctatgacatccgtggt
gtggtcggtcgcgacctcaacccacaggttgccgcgctcatcggccaggcgatcggtacg
atgatgcaggaacagggactcaacgaggtggtggtcggtcgcgacggtcgcctgtccggc
ccggaattggcggcggcgctgatcgacggtttgcgtcgtgccggttgtgccgtcatcgat
atcggcgttgcgccgaccccggtggtgtatttcgccagctaccatttgcgcgcaggcagt
tgcgtggcggtgaccggcagccacaaccccgccgactacaatggtttcaagatcgtgatc
ggcggtcagacgctgtccggtgcggccatcgccgagttgcatgcgtgcatctgcgagggc
cgtttgtcgaccgctgccgaaccgggccgactgcagcagcgcgacgtcggccgtgactac
gttcagcgcatcgccgacgacgtacagttggaccgcccgctcaaagtggtggtcgatgcc
ggcaacggtgtcggtggcgaactggggcctcggttgctggaggcgatcggcgcggaggtg
attccgttgtactgcgatgtcgatggtacctttcccaatcaccatcccgaccccagcgat
ccgcataatttggaagacttggtgcagacggtgcggcgcttcgatgccgacctcggcgtt
gctttcgacggcgacgccgaccggcttggcgtggtgactcatgacggcaaggtgatctat
cccgaccgcctgctgatgctgttcgccgccgatgtgttgcagcgtaatcccggtgcgttg
gtgatctacgacgtcaaatgcaccggcaagctgtcggattacgtgttacgtaacggcggt
agtccgctgatgtggaagaccggacattcgctgatcaaggcgaagatgcgcgagaccgat
gccgaattggcaggcgagatgagcgggcatttcttcttcaaggaacgttggtacggtttc
gacgatggcctttatgccgcggcgcggttgctggagatcctggcgcagcgcgaagagtcg
ccgtccgaggtgctggcggagttacccgagagcattgccacgccggagatcaaggtgccg
ctggatgggcaggatgggcatgcgttgattgcgcagttggccatccaggcacaacaggag
ggttcgccgttcgccggcgcgcgtttgttgaccctggatggtgtgcgtgccgatttcccg
gacggctgggggctggtgcgcgcgtctaacacgacgccagcgttggtgctacgtttcgag
gctgacaacgcgaccgcgctggaacgggtcaaggcgttgttccgcgcccagttgcagacg
gcgctgccgacggcgatgctcggcttttga

DBGET integrated database retrieval system