KEGG   Xanthomonas albilineans: XALc_0410Help
Entry
XALc_0410         CDS       T01160                                 

Definition
disulfide-isomerase oxidoreductase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
xal  Xanthomonas albilineans
Brite
Enzymes [BR:xal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     XALc_0410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(461275..462858)
Genome map
AA seq 527 aa AA seqDB search
MPHMSRMLRRPAILCTSLATLLALSACEKPPAPATPTAAAPAPTKDSAGIAWREGDLDDA
FAEAREQNKPLLLYWGAAWCPPCNRLKATLFKDPAFIARTRAFVAVHLDGDSESAQAWGD
RFGIKGYPTIIVLRPDRSEITRLAGDSDTAHLAEALRVAATHTSSSTQLLQQALKEPATL
SNDDWTILSQYDWSVDGAHLIKSEHTADVLARLAAAVPQPALRRRFGLLALSMDKTGTPT
PKQRAANRALLQAVLSDPAEVRANLGALTYSARELVQASAANAAERATLSSALTQALDKV
YTDSRLPISDRLETVYADIALARLAQGQPEVETHTPPPLPAALVEKIRQRAHWAEQAAHS
DAERQSTISSAADLLYLVGDKADAEQLLLAELGRSKTPYYYMPELSGMAEERGDKQTALY
WLKKAYASAQGPATRVQWGVVYVKGLIRLQPDNTTAIENAAGQVIAELASQPDGYHQRTR
QRFDTLGKALKVWSKNHSGSAVLARLQQKMQQNCGHQDTDNCQHWLS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgccccatatgagccgtatgctccgccgtcccgccatactctgcacaagtctagccacg
ttgctggccctgagcgcctgcgaaaagccgcccgctccggccacgcccacggccgccgcg
ccagcccccaccaaggacagtgccggcattgcctggcgcgagggcgacctcgacgatgcc
ttcgccgaagcccgtgaacagaacaaacccttactgctctactggggtgcggcgtggtgc
cccccctgcaatcgactcaaagccacgctgttcaaggacccggcattcatcgcccgtact
cgcgccttcgtggcggtgcatctggacggcgactcggaaagtgcacaagcctggggcgac
cgtttcggtatcaagggctatccgaccatcatcgtgctgcgtccggaccgcagcgaaatc
acccgtctggccggcgacagcgacaccgcccatctggccgaggcgctgcgggtggcggca
acccatacctccagctcgacacaattactgcagcaggccctgaaagaaccggctacgctc
agcaacgacgactggaccatactcagccaatacgactggagcgtagatggcgcgcacttg
atcaagtccgaacacaccgccgacgtgctcgcacgcctggccgccgccgtgccgcagcct
gcgctgcgccgtcgcttcgggttgttggcgctgagcatggacaaaaccggcacaccgacg
cccaaacagcgcgccgccaatcgcgccctgctacaggccgtgctgtccgatccggccgaa
gtgcgcgccaacctcggcgcactaacctattcggcacgtgaactggtgcaggcatcagcg
gcgaatgcagccgagcgcgctacgttgtcgagcgcgctgacgcaggcactggacaaggtc
tacaccgacagtcgcttgccgatcagtgatcgcctggagacggtctatgcagacatcgcg
ctggcgcggctggcgcagggccagccggaggtggagacgcatactccgccgccactgccg
gcggccttggtcgaaaaaatacggcaacgcgcgcactgggccgaacaggccgcacacagc
gatgccgaacgccagtccacgatcagcagcgccgccgacctgctctatttagtcggcgac
aaagccgacgccgaacagttgttgctcgccgaactcggacgcagcaagacgccttactac
tacatgcccgaattgtccgggatggccgaggagcgcggcgacaagcaaaccgcgctgtac
tggctgaagaaggcctatgcgagcgcacaaggcccggccacacgggtgcaatggggtgtg
gtctatgtcaagggcctgatccgcctgcaaccggacaacacaaccgccatcgaaaacgcc
gcaggccaggtcatcgccgaactggctagccagcccgacggctaccatcagcgtacccgg
cagcgcttcgacaccctgggcaaggcgctaaaggtctggagcaaaaatcacagcggtagc
gccgtgctggcacgcctgcagcagaaaatgcagcagaactgcggccaccaggacaccgac
aactgccaacactggctgagttga

DBGET integrated database retrieval system