KEGG   Xanthomonas albilineans: XALc_0443Help
Entry
XALc_0443         CDS       T01160                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
xal  Xanthomonas albilineans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    XALc_0443 (glpK)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     XALc_0443 (glpK)
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   XALc_0443 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
496483..497982
Genome map
AA seq 499 aa AA seqDB search
MEKQFILSIDQGTTSSRAILFDRHGRSVGMAQREFAQIFPQPGWVEHNPREIMTSVYTTI
TELLNTHQLDASAIAGIGITNQRETAVVWDRATGQPIYNAIVWQSRQTKDICEQLKADGH
EDMVRAKTGLLIDAYFSGTKIKWILDHVEGARLRAQRGELAFGTIDTWLIWNLTGGKVHV
TDYTNASRTLLYNIYALCWDEDLLRMLDIPASMLPQVRSSSEIYGSTQGQYFYGHGVQIA
GIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGEKAVVSNNGLLTTIAWGVDGKVEY
ALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDNDGVYFVPAFVGLGAPYWRSDI
RGAVFGLTRGTTKEHFIRAAIESMAYQTRDVLTAMQNDAGIKLKELRADGGAIANDFMAQ
FQSDILDVPVLRPEVAETTALGAAYLAGLATGFWKDRAEIAQHWAVDRRFEPTMPAERRE
ALYAGWQQAVEATMGFRIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcaattcatcctgtccatcgatcaaggtaccaccagttcgcgcgcgatcctg
ttcgaccgccatggtcgcagcgtcggcatggcccagcgcgagttcgcgcagatcttcccg
cagccgggctgggtcgagcacaacccgcgcgagatcatgaccagcgtctacaccacgatc
accgagttgttgaacacccatcagttggacgcgagcgcgatcgccggcatcggcatcacc
aaccagcgcgagaccgcggtggtgtgggaccgtgccaccggccaaccgatctacaacgcc
atcgtctggcagtcgcggcagaccaaggacatctgcgagcagctcaaggccgatggccac
gaggacatggtgcgggccaagaccgggctgctgatcgatgcgtatttttccggcaccaag
atcaagtggatcctcgaccatgttgagggcgcgcgcttgcgcgcgcagcgcggcgagctg
gcgttcggcaccatcgacacttggctgatctggaatctcaccggtggcaaggtgcatgtc
accgattacaccaatgcttcgcgcaccctgctgtacaacatttatgcgctgtgttgggac
gaagacctgctgcgaatgctcgacattcctgcatcgatgttgccgcaggtgcgctcgtcc
agcgaaatctacggcagcacgcagggccagtatttttacggccacggggtgcagatcgcg
ggcatcgcgggtgatcaacaggcggccttgttcggtcaggcctgtttcgagccgggcatg
gcgaaaaacacctacggcaccggctgtttcatgctgatgcacactggcgagaaggcggtg
gtgtcgaacaatggcctgctcaccaccatcgcctggggcgtggacggcaaggtggaatac
gcgctggagggggcgatcttcgtcgccggctcggtggtgcaatggctgcgcgatggcctg
cgcatgttcggcaaagccagcgattcgcaggcctacgccgagcgtgccggcgacaacgac
ggcgtgtacttcgtgccggccttcgtcggcctgggggcaccgtactggcgcagcgacatc
cgtggcgcggtgtttggcctgacccgtgggaccaccaaggaacatttcattcgtgccgcg
atcgagtcgatggcctaccagacccgcgacgtgttgacggcgatgcagaacgatgccggt
atcaagttgaaggaactacgcgccgatggcggcgcgatcgccaacgatttcatggcccag
ttccagagcgacatccttgacgtgccggtgttgcgcccggaggtggccgagaccaccgcg
ttgggcgctgcctatctggcgggcttggcgacgggattttggaaggaccgtgccgagatc
gcgcagcactgggcggtggatcgccgcttcgaaccgaccatgccggccgagcgccgcgag
gcgttgtacgcgggctggcaacaggcggtggaggcgacgatgggttttcgtattcgctga

DBGET integrated database retrieval system