KEGG   Xanthomonas albilineans: XALc_0490Help
Entry
XALc_0490         CDS       T01160                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-c-methyl-d-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
xal  Xanthomonas albilineans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:xal00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
544679..545560
Genome map
AA seq 293 aa AA seqDB search
MGHSGVMIQASDGGWSYWPAPAKLNLFLQITGRRADGYHQLQTVFRLLDWGDTVSVRPRA
DGVVVRIGPSVAGVAEADDLLVRAAILLQKEAKIAKGVDIRVEKRIPAGGGFGGGSSDAA
TVLVALNALWGAGLDEDALARLGLSLGADVPVFVRGRDAWAEGIGERLTPIALPPAWYVL
VDPGVHVPTATLFQSADLTRDAAPAKIADFVSGFLLGNAFEPVLLRREPAVQAAFQALAR
IGTPRLTGSGSGCFVEFADRAAAQRALADLPNGMRAWVAGGVARSPLLDALEV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggacattccggcgtcatgatccaggcgtcggacgggggctggtcgtattggccggcc
ccggcgaagctgaacctgtttctccagatcacgggccgccgtgccgacggttatcaccag
ttgcagaccgtgttccgcctgctcgattggggcgacacggtgtctgtgcggccgcgcgcc
gacggcgtggtggtgcgcatcggcccttccgtggcgggtgtcgccgaggccgacgatcta
ctggtgcgggcggccattttgctgcaaaaagaagccaaaatcgccaaaggggtggatatt
cgcgtcgaaaagcggattcctgccggcggcggttttggtggcggatcgtcggatgcggcc
acggtgttggtcgcgctgaacgcgctgtggggtgccggtctggatgaagacgcactggcc
cggttggggctgtcgctgggcgctgacgtgccggtgttcgtgcgcggccgcgatgcctgg
gccgagggcattggcgagcgcttgactccgatcgcgttgcctccggcctggtatgtcctg
gtcgatccgggcgttcatgtgcccacggcgaccctgttccagtctgcggatttgacgcgg
gatgccgcgcccgcgaaaatagccgacttcgtttcaggtttcctgctcgggaatgcgttc
gagccggtcctgcttcgccgcgaacccgctgtccaggcggcgttccaggcgctggcacgg
atcggaacgccgcgcttgaccggatcgggaagcggttgtttcgtcgagttcgctgatcgc
gccgccgcacagcgtgcgctggcggacttgccgaacgggatgcgcgcctgggtggcaggc
ggcgtggctcgctcgccgctgctcgacgcgctggaggtttga

DBGET integrated database retrieval system