KEGG   Xanthomonas albilineans: XALc_0614Help
Entry
XALc_0614         CDS       T01160                                 

Gene name
recR
Definition
recombination protein RecT
Orthology
K06187  
recombination protein RecR
Organism
xal  Xanthomonas albilineans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:xal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    XALc_0614 (recR)
DNA repair and recombination proteins [BR:xal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      XALc_0614 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661244..661858
Genome map
AA seq 204 aa AA seqDB search
MSSPLLEQLIEAFRILPGVGQKTAQRMAYHVLERERAGGQRLADTLHAAIARVGHCTQCR
DFSETDICAICASPGRDRQQLCVVESPADRLAIEQATGYRGLYFILQGRLSPLDGIGPRE
LGLDRLGARLAQGEVAELIIATNSTVEGEATAHYLAQLARQHGVRPSRLAQGLPLGGELE
YVDRGTLSHAFGSRNEVPRGGVGE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgccgctgctcgaacagttgatcgaggcgttccgcatcctgccgggggtcggt
cagaaaaccgcgcagcggatggcgtatcacgtgctcgaacgcgaacgcgccggtgggcag
cgtctggccgacaccctgcatgcggcgattgcgcgggtcggccactgcacgcaatgccgc
gatttcagcgaaaccgatatctgtgcgatctgcgccagccctggtcgtgaccgccaacag
ttgtgcgtggtggagtcgccggccgaccgcttggcgatcgaacaggccaccggctatcgc
gggctgtatttcattctgcagggacggctgtcgccactggacggcatcggtccgcgcgaa
ctcggtctggatcgactcggcgcgcggctggcgcagggcgaggtcgccgaactgatcatc
gccaccaattccacggtcgagggcgaggccaccgcgcattatctggcgcagttggcccgc
cagcatggtgtgcggccgagccggctggcgcagggcttgccgctgggcggtgaactggaa
tacgtggaccgcggcacgttgtcgcatgcgttcggcagccgcaacgaagtgccgcgcggc
ggcgtgggcgagtag

DBGET integrated database retrieval system