KEGG   Xanthomonas albilineans: XALc_0614Help
Entry
XALc_0614         CDS       T01160                                 

Gene name
recR
Definition
recombination protein RecT
Orthology
K06187  
recombination protein RecR
Organism
xal  Xanthomonas albilineans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:xal03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
661244..661858
Genome map
AA seq 204 aa AA seqDB search
MSSPLLEQLIEAFRILPGVGQKTAQRMAYHVLERERAGGQRLADTLHAAIARVGHCTQCR
DFSETDICAICASPGRDRQQLCVVESPADRLAIEQATGYRGLYFILQGRLSPLDGIGPRE
LGLDRLGARLAQGEVAELIIATNSTVEGEATAHYLAQLARQHGVRPSRLAQGLPLGGELE
YVDRGTLSHAFGSRNEVPRGGVGE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgccgctgctcgaacagttgatcgaggcgttccgcatcctgccgggggtcggt
cagaaaaccgcgcagcggatggcgtatcacgtgctcgaacgcgaacgcgccggtgggcag
cgtctggccgacaccctgcatgcggcgattgcgcgggtcggccactgcacgcaatgccgc
gatttcagcgaaaccgatatctgtgcgatctgcgccagccctggtcgtgaccgccaacag
ttgtgcgtggtggagtcgccggccgaccgcttggcgatcgaacaggccaccggctatcgc
gggctgtatttcattctgcagggacggctgtcgccactggacggcatcggtccgcgcgaa
ctcggtctggatcgactcggcgcgcggctggcgcagggcgaggtcgccgaactgatcatc
gccaccaattccacggtcgagggcgaggccaccgcgcattatctggcgcagttggcccgc
cagcatggtgtgcggccgagccggctggcgcagggcttgccgctgggcggtgaactggaa
tacgtggaccgcggcacgttgtcgcatgcgttcggcagccgcaacgaagtgccgcgcggc
ggcgtgggcgagtag

DBGET integrated database retrieval system