KEGG   Xanthomonas albilineans: XALC_0670Help
Entry
XALC_0670         CDS       T01160                                 

Gene name
sucC
Definition
(GenBank) hypothetical succinyl-coa synthetase beta chain (scs-beta) protein (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
xal  Xanthomonas albilineans
Pathway
Biosynthesis of antibiotics
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XALC_0670 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XALC_0670 (sucC)
   00640 Propanoate metabolism
    XALC_0670 (sucC)
   00660 C5-Branched dibasic acid metabolism
    XALC_0670 (sucC)
Enzymes [BR:xal01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     XALC_0670 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
727724..728887
Genome map
AA seq 387 aa AA seqDB search
MNFHEYQAKQLFANYGIPVPAGRIASTPEEAVEAANALGDGPWMVKAQIHAGGRGKAGGV
KFCKTTDDVKAAAAKMLGTKMATYQSAGVALPVNLVLVTTAGEIVKELYLSLLVDRDQKS
ITYIVSSEGGVDIEEVAATTPEKIHTLVVDYAEGVQPYQGREIGFKMGLTAKQANQLANI
MGGLYALFNDKDLSLVELNPLAILDDQNLYALDGKVNSDDNATFRRKDLAAMRDTTQEDE
TEVKASEHDLNYVTMDGNIGCMVNGAGLAMATMDVIALNGGAPANFLDVGGGATKERVTE
AFKLILSSDKVKAIFVNIFGGIVRCDMIAEGIIAAVKEVDVKVPVVVRLEGTNVEAGKTL
LADSGLAITPADDINDGAKKAVAAVAA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccaggcgaaacaactgtttgccaactacggcatcccggttccg
gccggacgcatcgcgtccacgccggaagaagccgtcgaagcggccaatgccttgggcgat
ggcccctggatggtcaaggcccaaatccatgcgggcggccgcggcaaggccggcggcgtg
aagttctgcaagaccaccgacgatgtcaaagccgccgcggccaagatgctcggtaccaag
atggccacctaccagtccgcaggcgtggcactgccggtcaatctggtgctggtgaccact
gccggcgagatcgtcaaggagctgtatttatcgctgctggtcgatcgcgaccagaagtcg
atcacctatatcgtctccagcgaaggcggcgtggacatcgaggaagtcgccgccaccacg
cccgagaagatccacacccttgtggtggactacgccgaaggcgtgcagccctaccaggga
cgcgagatcggcttcaagatgggactgaccgccaagcaggccaatcagctggccaacatc
atgggcgggctgtacgcgctgttcaacgacaaggatctgtcgctggtcgaactgaacccg
ctggcgattctcgacgaccagaacctctacgcgctggatggcaaggtcaactccgacgac
aacgccactttccgtcgcaaggatctggctgccatgcgcgataccacgcaggaagacgaa
accgaggtcaaggccagcgagcacgacctcaactacgtcaccatggacggcaacatcggc
tgcatggtcaacggcgccggcttggcgatggccacgatggatgtgatcgcgctcaacggc
ggtgcgccggccaacttcctcgacgtgggcggcggcgccaccaaggaacgcgtgaccgag
gcgttcaagctcatcctgtccagcgacaaggtcaaggccatcttcgtcaacatcttcggc
ggcatcgtccgctgtgacatgatcgccgagggcatcatcgccgcggtcaaggaagtggac
gtcaaggtgccggtggtggtgcgactggaaggcaccaatgtggaagcgggcaagacgctg
ctggccgactccggcctggccatcaccccggccgacgacatcaacgacggtgccaagaag
gccgtcgctgccgtcgctgcctga

DBGET integrated database retrieval system