KEGG   Xanthomonas albilineans: XALC_0767Help
Entry
XALC_0767         CDS       T01160                                 

Gene name
pfkA
Definition
(GenBank) probable 6-phosphofructokinase protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xal  Xanthomonas albilineans
Pathway
Biosynthesis of antibiotics
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XALC_0767 (pfkA)
   01230 Biosynthesis of amino acids
    XALC_0767 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_0767 (pfkA)
   00030 Pentose phosphate pathway
    XALC_0767 (pfkA)
   00051 Fructose and mannose metabolism
    XALC_0767 (pfkA)
   00052 Galactose metabolism
    XALC_0767 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    XALC_0767 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    XALC_0767 (pfkA)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     XALC_0767 (pfkA)
Protein phosphatases and associated proteins [BR:xal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     XALC_0767 (pfkA)
Messenger RNA biogenesis [BR:xal03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     XALC_0767 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(850307..851563)
Genome map
AA seq 418 aa AA seqDB search
MAQGTLLYAQSGGVTAVINASAAAVIGEARARKVKVLAARNGILGALREDLIDTSKESAA
AIRALAHTPGGAFGSCRYKLKSLEADRPRYERLLQVLQAHQVRYFLYNGGNDSADTAWKV
AQLAQAFDYPLHCIGVPKTIDNDLTVTDTCPGFGSAAKYTAVAVREAALDVAAMAETSTK
VFVYEAMGRHAGWLAAAAGLAAQSPDDAPQIILFPERAYDEAAFLAQVRKVVDQVGWCVV
VASEGIRTADGRFVADVGGGTDAFGHSQLGGVAAYLAGKVKSELGYKVHWTLPDYLQRSA
RHIASRTDWEQAQAVGKAAVQFALNGMNAVMPAIVRSSDAPYRWKIEAAPLSKVANHEKK
MPPSFLRKDGFGITEKARRYLQPLIRGEAPLAYGNDGLPKYVTLKNVAVKKKLPAWEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaggcaccctgctctacgcccaatccggcggcgtcaccgccgtcatcaacgcc
agcgccgccgccgtgatcggcgaagcacgggcgcgcaaggtcaaggtgctggccgcgcgt
aacggcattctcggcgcactgcgcgaagacctgatcgacacctccaaggaatcggcggcg
gcgatccgcgcgctggcacacaccccgggcggcgccttcggctcttgccgctacaagctc
aaatcgctggaagccgatcgccccaggtacgagcgcctgctacaagtgttgcaagcgcat
caggtacgctacttcctctacaacggcggcaacgattcggccgataccgcctggaaggtc
gcacaactggcacaggcattcgactatcccctgcattgcatcggcgtgcccaagaccatc
gacaacgacctgacggtgaccgacacctgccccggtttcggctcggcggccaaatacact
gcggtggcggtgcgggaagcggcgctggacgtggccgccatggcggaaacctcgaccaag
gtctttgtctacgaggccatgggccggcatgccggctggctcgctgccgccgccgggctg
gccgcgcagtcgccggacgatgcaccgcagatcatcctgttccccgagcgcgcctacgac
gaggcggccttcctggcacaggtgcgcaaggtggtggatcaggtcggttggtgcgtggtg
gtggccagcgaaggcattcgaaccgcggacgggcgcttcgtcgccgatgtaggcggcggc
accgacgcgttcgggcacagccagctcggcggcgtggcggcgtacctcgccggcaaggtc
aagtcagaactcggctacaaggtgcactggaccctgcccgactacctgcaacgctcggca
cgccatatcgcctcgcgcaccgactgggaacaggcacaggcggttggcaaggcggcggtg
caattcgccctcaacggcatgaacgcggtgatgccggcgatcgtgcgcagcagcgatgcg
ccctaccgttggaagatcgaggccgcgccgctgagcaaggtcgccaaccatgagaaaaaa
atgccgccgtcgttcctgcgcaaggacggcttcggcatcaccgagaaagcccgccgctac
ctgcaaccgttgatccgcggcgaagcgccgctggcttatggcaacgacggcctgcccaaa
tacgtgacactgaaaaacgtggcggtgaagaaaaaactaccggcctgggaaggatga

DBGET integrated database retrieval system