KEGG   Xanthomonas albilineans: XALC_0832Help
Entry
XALC_0832         CDS       T01160                                 

Gene name
folK
Definition
(GenBank) probable 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase protein (EC:2.7.6.3)
  KO
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xal  Xanthomonas albilineans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XALC_0832 (folK)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XALC_0832 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
944342..944845
Genome map
AA seq 167 aa AA seqDB search
MTTVLLSLGSNLRPQHHLAVALEALHERFGPIVVSPTYRTAAVGFDGAAFLNNAVALQTD
WGLIPLDAWLHALEDAHGRDRNGPRFGDRTLDIDIVFYGDCIAEGPGNLRIPRPELRHAF
VLKPLADIAADFVDPISGLTLGALWRAHAEHGAVFEVVALEGAGTPG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtgctactgagtctaggcagcaacctgcgcccgcagcatcacctggccgtc
gcgctcgaagcattgcatgagcgcttcggtccgatcgtggtgtcgcctacgtaccggacc
gctgcggtgggcttcgacggagcggcattcctgaataacgcggtggcgttgcagacggat
tggggcctgataccgctggacgcctggttgcatgcgctggaagacgcgcacggacgcgat
cgcaatggtccgcgctttggcgaccgcaccttggacatcgatatcgtgttctatggcgac
tgcattgccgaaggtccaggcaatttgcggatcccgcgccccgagctgcgccatgccttc
gtgctgaagccgctggctgacatcgccgccgatttcgtcgacccgatcagtggcctgacg
ttgggggcactttggcgggcgcatgccgagcatggagcggtgttcgaggtggtggcgctg
gagggggccgggactccagggtag

DBGET integrated database retrieval system