KEGG   Xanthomonas albilineans: XALC_0947Help
Entry
XALC_0947         CDS       T01160                                 

Gene name
galM
Definition
(GenBank) probable aldose 1-epimerase (mutarotase) protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
xal  Xanthomonas albilineans
Pathway
xal00010  Glycolysis / Gluconeogenesis
xal00052  Galactose metabolism
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_0947 (galM)
   00052 Galactose metabolism
    XALC_0947 (galM)
Enzymes [BR:xal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     XALC_0947 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: CBA15464
UniProt: D2UCA4
Position
1070108..1071160
Genome map
AA seq 350 aa AA seqDB search
MSSIFGHLPDGTAIHRLVLDRGHGLRAELLTYGGLLRSLRLDTAHGPVEMVLGLPTLQAY
LHDPAYLGVLVGRFGNRIAGSAFTLDGQRYPLTANEGANHLHGGAQGFGRRVWTVVAQST
SELQLRYDSPAGEEGYPGALRVEAAFRLHDHCLELEFVAQTDAPTPLNLTHHPYFNLAGD
PAVAAAAQWLRVPAEGYLPVCDAGMLPRGEIAGVAATPFDFRSPRAIADKDIAADPQLCL
SAGYDHCLVLAQARDYSALLYSPYSGVAMRLDSPMPALQLYEGQGLDRQHPHLGRGICLE
PQGYPDAPNQPGFPDTILRPGQIYRHRIQYRFAEVGAGADWAAVEAALVG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcgatcttcggccatcttcccgacggcaccgccattcatcgcctggtcctggac
cgcgggcatggcctgcgcgccgaactgctgacttacggtggtctgctgcgcagcctgcgc
ctggacaccgcgcacggtcctgtcgaaatggtgctggggctgccgacgttgcaggcgtat
ctgcacgatccggcgtatctgggcgtgttggtcggtcgtttcggcaatcgcatcgccggg
tcggcgttcacgctcgatgggcagcgttatcctttgaccgccaacgagggggctaaccat
ttgcacggcggcgcacagggtttcggacggcgcgtgtggacggtcgtggcgcagtccacg
agcgaactacaactgcgttacgactcgccggccggcgaggaaggctatcccggagcgttg
cgggtggaagcggcgtttcgtctgcacgatcattgcctggagttggagttcgtcgcgcag
accgatgcgcccacgccgctcaacctcacccatcatccgtatttcaatctggccggcgat
cccgccgtggccgcggcggcgcagtggctacgcgtgcccgccgagggctacctgcctgtg
tgcgatgcgggcatgctgccccgcggcgagatcgccggcgttgccgccacgccgttcgat
ttccgcagcccacgtgcgatcgccgacaaggacatcgccgccgatccgcaactgtgcctg
agtgccggttacgatcattgcctggtgctggcgcaggcgcgcgactacagcgcgctgctg
tactcgccgtacagcggcgtggcgatgcgtctggacagtccgatgccggcgctgcaactg
tacgaggggcaggggctggaccggcagcatccgcacctgggacgcggcatttgtctggag
ccgcaaggctatccagatgcaccgaaccagcctgggttccccgacacgatcctgcgcccg
gggcagatctatcggcatcgcatccaataccgctttgccgaggtcggtgcgggcgccgat
tgggctgcggtggaggccgcactggtcgggtga

DBGET integrated database retrieval system