KEGG   Xanthomonas albilineans: XALc_0986Help
Entry
XALc_0986         CDS       T01160                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase beta chain protein (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xal  Xanthomonas albilineans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XALc_0986 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALc_0986 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XALc_0986 (trpB)
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XALc_0986 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112610..1113827
Genome map
AA seq 405 aa AA seqDB search
MASVPVSDFHAYPDAAGHFGRYGGRFVAETLIGPLQELAAAYDAARQDPAFIAAYDKDLA
HYVGRPSPIYHAERLSREVGGARILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLQDYGRLPDAISA
CVGGGSNAIGLFHAFLNDASVKIYGAEAAGDGIASGRHAASIAAGRPGVLHGNRTYVICD
DDGQIIETHSVSAGLDYPGVGPEHAFLADSGRATYQGITDDEALAAFHLLAHTEGILAAL
ESSHAVAQAIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLTL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgttcccgtcagtgacttccacgcctatcccgatgccgccggccatttcggt
cgctatggcggtcgtttcgtcgccgagaccctgatcggcccgctgcaggagttggccgcg
gcctacgatgccgcgcgccaggatcccgcgttcatcgccgcctacgacaaggatctggcc
cattacgtcggccggcccagcccgatctaccatgccgagcggctcagtcgcgaagttggc
ggtgcgcggatcctgctcaaacgcgaagacctcaatcacactggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagtcgcatgggcaagacccgcatcatcgccgag
accggcgccggccaacacggtgtggccagcgccaccgtggccgcgcggctggggctggag
tgcgtggtgtacatgggggccaccgatatcgagcggcagaagatcaacgtctaccggatg
aagttgcttggcgccacggtggtgccggtgacttccggttcggccacgctcaaggacgcg
ctcaacgaggcgatgcgcgactgggtgaccaacgtgcaggacaccttctacatcatcggt
accgtcgccggtcccgatccgtatccgcgcatggtgcgcgatttcaacgccatcgtcggg
cgcgaagcgcgcgcgcaaatgttgcaggactacggtcgcctgccggatgcgatcagcgcc
tgcgtcggtggcggcagcaatgccatcggtctgttccacgccttcctcaacgatgcttcg
gtgaaaatttacggtgccgaagccgctggcgacggcatcgccagcggtcgccatgccgcc
tcgatcgcggctgggcgtcccggtgtgctgcatggcaatcgcacttacgtgatctgcgac
gacgatgggcagatcatcgagacccattcggtgtccgccggcctggactatccgggcgtc
ggtcctgagcatgcctttctggccgacagcggtcgtgccacctatcagggcatcaccgac
gacgaggcactggccgcgttccatctgctggcgcatacggagggcatcctcgctgcactg
gagtccagccacgcggttgcacaagcgatcaagctggcgcgggagttgcctaaagacgcg
ctggtgctgtgcaacctgtccggtcgcggcgacaaggatgtgcacaccatcgccgcgcgc
gaagggttgacgctgtga

DBGET integrated database retrieval system