KEGG   Xanthomonas albilineans: XALc_0986Help
Entry
XALc_0986         CDS       T01160                                 

Gene name
trpB
Definition
tryptophan synthase beta chain protein (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
xal  Xanthomonas albilineans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XALc_0986 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALc_0986 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XALc_0986 (trpB)
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XALc_0986 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1112610..1113827
Genome map
AA seq 405 aa AA seqDB search
MASVPVSDFHAYPDAAGHFGRYGGRFVAETLIGPLQELAAAYDAARQDPAFIAAYDKDLA
HYVGRPSPIYHAERLSREVGGARILLKREDLNHTGAHKINNTIGQALLASRMGKTRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREARAQMLQDYGRLPDAISA
CVGGGSNAIGLFHAFLNDASVKIYGAEAAGDGIASGRHAASIAAGRPGVLHGNRTYVICD
DDGQIIETHSVSAGLDYPGVGPEHAFLADSGRATYQGITDDEALAAFHLLAHTEGILAAL
ESSHAVAQAIKLARELPKDALVLCNLSGRGDKDVHTIAAREGLTL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgttcccgtcagtgacttccacgcctatcccgatgccgccggccatttcggt
cgctatggcggtcgtttcgtcgccgagaccctgatcggcccgctgcaggagttggccgcg
gcctacgatgccgcgcgccaggatcccgcgttcatcgccgcctacgacaaggatctggcc
cattacgtcggccggcccagcccgatctaccatgccgagcggctcagtcgcgaagttggc
ggtgcgcggatcctgctcaaacgcgaagacctcaatcacactggcgcgcacaagatcaac
aacaccatcggccaggccctgctggccagtcgcatgggcaagacccgcatcatcgccgag
accggcgccggccaacacggtgtggccagcgccaccgtggccgcgcggctggggctggag
tgcgtggtgtacatgggggccaccgatatcgagcggcagaagatcaacgtctaccggatg
aagttgcttggcgccacggtggtgccggtgacttccggttcggccacgctcaaggacgcg
ctcaacgaggcgatgcgcgactgggtgaccaacgtgcaggacaccttctacatcatcggt
accgtcgccggtcccgatccgtatccgcgcatggtgcgcgatttcaacgccatcgtcggg
cgcgaagcgcgcgcgcaaatgttgcaggactacggtcgcctgccggatgcgatcagcgcc
tgcgtcggtggcggcagcaatgccatcggtctgttccacgccttcctcaacgatgcttcg
gtgaaaatttacggtgccgaagccgctggcgacggcatcgccagcggtcgccatgccgcc
tcgatcgcggctgggcgtcccggtgtgctgcatggcaatcgcacttacgtgatctgcgac
gacgatgggcagatcatcgagacccattcggtgtccgccggcctggactatccgggcgtc
ggtcctgagcatgcctttctggccgacagcggtcgtgccacctatcagggcatcaccgac
gacgaggcactggccgcgttccatctgctggcgcatacggagggcatcctcgctgcactg
gagtccagccacgcggttgcacaagcgatcaagctggcgcgggagttgcctaaagacgcg
ctggtgctgtgcaacctgtccggtcgcggcgacaaggatgtgcacaccatcgccgcgcgc
gaagggttgacgctgtga

DBGET integrated database retrieval system