KEGG   Xanthomonas albilineans: XALc_0987Help
Entry
XALc_0987         CDS       T01160                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit Alpha protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xal  Xanthomonas albilineans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XALc_0987 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALc_0987 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XALc_0987 (trpA)
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XALc_0987 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1113970..1114788
Genome map
AA seq 272 aa AA seqDB search
MSVAVGRIAARLEVLRQAGRKALIPFVTAGDPSLEATVPAMHALVEAGADVIELGVPFSD
PMADGPTIQRSSERALARGAGLRYVLDTVSTFRRDDMVTPVVLMGYLNPVEIHGTARFAE
EAVAAGVDGVLLVDLPPEESVETLAVFADAGLDLIVLASPTTSDARLNLLCDTARGYLYY
VSFAGVTGADRLDTHAAGDRLRQLRARCPVPVVAGFGIKDAASAKAMATDADGVVVGSAL
VAALAEAATPQAARAAALAFLAPLRQALDAHG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgcggtggggcgcatcgccgcgcggttggaggtgttgcgtcaggctgggcgc
aaggcgttgattccgttcgtgaccgccggtgacccgtcgctggaggcgaccgtgccggcg
atgcatgccttggtcgaggccggtgccgacgtgatcgaattgggcgtgccgttttccgat
ccgatggccgatggtccgaccatccaacgcagttccgagcgcgcgttggcacgcggtgcc
gggctgcgctacgtgctggatacggtcagtacattccgccgtgacgacatggtcacgcct
gtggtgctgatgggctatctcaacccggtcgaaatccacggaactgcgcgttttgccgag
gaagcggtcgccgccggcgtggatggcgtgctgttggtcgatttgccgccggaagagtcg
gtcgagaccctggcggtgttcgccgatgccggtctggatttgatcgtgcttgcctcgcca
accaccagcgatgcgcgcctgaatctgctgtgcgataccgcgcgcggttacctctattac
gtcagtttcgctggcgtgaccggcgccgaccggctggatacgcatgccgccggggatcgg
ttgcgccaattgcgggcgcgttgtccggtgccggtggtggccggcttcggcatcaaggac
gcggccagcgctaaggccatggcgaccgatgccgatggcgtggtggttggcagcgccctg
gtcgccgccttggccgaggccgcgactccgcaggcggcgcgcgccgctgccctggcgttc
ctggcgcccttgcgacaggcgttggacgcgcacggctag

DBGET integrated database retrieval system