KEGG   Xanthomonas albilineans: XALC_0987Help
Entry
XALC_0987         CDS       T01160                                 

Gene name
trpA
Definition
(GenBank) probable tryptophan synthase alpha chain protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
xal  Xanthomonas albilineans
Pathway
xal00260  Glycine, serine and threonine metabolism
xal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01130  Biosynthesis of antibiotics
xal01230  Biosynthesis of amino acids
Module
xal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALC_0987 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    XALC_0987 (trpA)
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     XALC_0987 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA TMP-TENI Dus PcrB His_biosynth IMPDH DUF561
Motif
Other DBs
NCBI-ProteinID: CBA15504
UniProt: D2UCP7
Position
1113970..1114788
Genome map
AA seq 272 aa AA seqDB search
MSVAVGRIAARLEVLRQAGRKALIPFVTAGDPSLEATVPAMHALVEAGADVIELGVPFSD
PMADGPTIQRSSERALARGAGLRYVLDTVSTFRRDDMVTPVVLMGYLNPVEIHGTARFAE
EAVAAGVDGVLLVDLPPEESVETLAVFADAGLDLIVLASPTTSDARLNLLCDTARGYLYY
VSFAGVTGADRLDTHAAGDRLRQLRARCPVPVVAGFGIKDAASAKAMATDADGVVVGSAL
VAALAEAATPQAARAAALAFLAPLRQALDAHG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtcgcggtggggcgcatcgccgcgcggttggaggtgttgcgtcaggctgggcgc
aaggcgttgattccgttcgtgaccgccggtgacccgtcgctggaggcgaccgtgccggcg
atgcatgccttggtcgaggccggtgccgacgtgatcgaattgggcgtgccgttttccgat
ccgatggccgatggtccgaccatccaacgcagttccgagcgcgcgttggcacgcggtgcc
gggctgcgctacgtgctggatacggtcagtacattccgccgtgacgacatggtcacgcct
gtggtgctgatgggctatctcaacccggtcgaaatccacggaactgcgcgttttgccgag
gaagcggtcgccgccggcgtggatggcgtgctgttggtcgatttgccgccggaagagtcg
gtcgagaccctggcggtgttcgccgatgccggtctggatttgatcgtgcttgcctcgcca
accaccagcgatgcgcgcctgaatctgctgtgcgataccgcgcgcggttacctctattac
gtcagtttcgctggcgtgaccggcgccgaccggctggatacgcatgccgccggggatcgg
ttgcgccaattgcgggcgcgttgtccggtgccggtggtggccggcttcggcatcaaggac
gcggccagcgctaaggccatggcgaccgatgccgatggcgtggtggttggcagcgccctg
gtcgccgccttggccgaggccgcgactccgcaggcggcgcgcgccgctgccctggcgttc
ctggcgcccttgcgacaggcgttggacgcgcacggctag

DBGET integrated database retrieval system