KEGG   Xanthomonas albilineans: XALc_0996Help
Entry
XALc_0996         CDS       T01160                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (tim) (triose-phosphate isomerase) protein (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
xal  Xanthomonas albilineans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XALc_0996 (tpiA)
   01230 Biosynthesis of amino acids
    XALc_0996 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALc_0996 (tpiA)
   00051 Fructose and mannose metabolism
    XALc_0996 (tpiA)
   00562 Inositol phosphate metabolism
    XALc_0996 (tpiA)
Enzymes [BR:xal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     XALc_0996 (tpiA)
Exosome [BR:xal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   XALc_0996 (tpiA)
  Exosomal proteins of bladder cancer cells
   XALc_0996 (tpiA)
  Exosomal proteins of melanoma cells
   XALc_0996 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1123859..1124614
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAANWKLHGTRQGAHALLQAVVAGLSGDAVEVVILPPLPYLAGLIEAFQRRELCF
GAQDVSCNVQGAYTGEVSAAMLVDVGADYGLVGHSERRQYQHESSELVARKFAAAIAAGL
RPILCVGETLEQRQAGQTEAAIAAQLTPVLALVGGEGFANAVISYEPVWAIGTGRTASPA
QAQAVHAFIRGEVAARDARIADSLPILYGGSVKPDNAAELFAQPDVDGGLVGGASLVAAQ
FLAIVQAAAAC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaagatcgtagctgcaaattggaaattgcatggcactcgccagggcgctcac
gcgctgctgcaggcggtggtcgcaggcttgtccggtgatgcggtggaggtggtgattctg
ccgccattgccgtatctggctggcctgatcgaggcgttccagcgtcgcgagttgtgtttc
ggagcccaggatgtcagctgcaacgtgcagggtgcctatacgggcgaggtgtcggcggcg
atgctggtcgatgtcggtgccgactatgggttggtcgggcattcggagcggcgccagtat
caacacgagagcagtgagctggtggcgcgcaagttcgccgcggccattgctgccgggctg
cgcccgatcctgtgcgtgggcgagaccctggagcagcgtcaggccgggcagaccgaggcg
gccatcgccgcgcaactgacgccggtgctggccctggtcggcggggagggcttcgccaac
gcggtgatctcctacgagccggtgtgggcgatcggtaccgggcgcaccgccagcccggcg
caggcgcaggcggtacatgccttcattcgtggcgaagtggctgcccgcgatgctagaatc
gcagattcgctgcccatcctgtatggcggcagcgtcaagcccgacaacgccgcggagctg
ttcgcgcagcccgatgtggatggtgggctggtcggcggtgcctcgctggttgccgcgcaa
ttcctggccatcgtgcaagcggcggccgcctgttaa

DBGET integrated database retrieval system