KEGG   Xanthomonas albilineans: XALC_1049Help
Entry
XALC_1049         CDS       T01160                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase superfamily protein (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
xal  Xanthomonas albilineans
Pathway
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XALC_1049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALC_1049
  Lipid metabolism
   00071 Fatty acid degradation
    XALC_1049
  Amino acid metabolism
   00350 Tyrosine metabolism
    XALC_1049
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XALC_1049
   00626 Naphthalene degradation
    XALC_1049
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XALC_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
1178114..1179130
Genome map
AA seq 338 aa AA seqDB search
MKAAVVHKFGGPLEIEEVTVPQPGFGEILVKIEACGVCHTDLHAVHGDWPVKPTLPFIPG
HEGVGYIVALGPGVIHLKEGDRVGVPWLYSACGHCEHCLGGWETLCETQKNTGYSVNGAF
AEYALAAADYVGHLPDNVGFVEIAPVLCAGVTTYKGLKVTDTRPGQWVAISGIGGLGHMA
VQYAKAMGLKVAAVDVDDAKLDLARRLGAEITVNAKNIDPALFLKKEIGGVHGALVTAVS
PSAFSQAMNMVRRGGTVSLNGLPPGKFDLSIFDMVLNGVTVRGSIVGTRLDLQESLDIAK
DGKVVATVSRERLDNINDVFKRMREGNIEGRVVLDFAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggttgtccataaattcggtggcccactggaaatcgaggaggtaacggta
ccgcaaccggggtttggcgagatactagtgaagatcgaggcctgtggcgtgtgccacacc
gacttgcatgcggtgcatggcgactggccggtaaagcccacattgcccttcattccgggt
catgagggagtaggctacatcgttgcgctcgggcctggcgtcatccacttgaaagagggg
gaccgcgttggcgtgccttggctatactcggcttgcggtcattgcgagcattgtctgggc
ggctgggagacgctgtgcgaaacgcagaagaacaccggttactcggtcaacggcgctttt
gccgaatacgctctcgctgctgccgactacgtgggccatctgccggataacgtgggcttt
gtcgagatcgcgccggtgctgtgtgcgggcgtcactacatacaaggggttgaaggtcacc
gacacccggcctggccagtgggtagctatttccggcatcggaggcctgggccacatggca
gtgcagtacgcgaaggcgatgggactcaaagttgcagcggtggacgtcgacgatgccaag
ctagatctggcgcgtcggctcggcgcggagatcacggtcaacgcaaagaacatcgatcca
gcgctttttcttaagaaggaaatcggcggtgtgcacggcgcactggtgactgccgtttcg
cctagtgcattcagtcaggcgatgaacatggtgcgccgtggcgggaccgtgtcgcttaat
ggcctaccgcctggaaaattcgacctgtcgatcttcgacatggtgctcaacggagtcact
gtgcgcggttcgatcgtcggcacccgcctggatctacaggagtcgctggatatcgcgaag
gatggcaaagtggtggccacggtctctagagagagactggacaacatcaacgatgtattc
aaacgtatgcgtgaaggcaacatcgagggcagggtagtactggacttcgctgcctaa

DBGET integrated database retrieval system