KEGG   Xanthomonas albilineans: XALc_1049Help
Entry
XALc_1049         CDS       T01160                                 

Definition
zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
xal  Xanthomonas albilineans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    XALc_1049
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    XALc_1049
  Lipid metabolism
   00071 Fatty acid degradation
    XALc_1049
  Amino acid metabolism
   00350 Tyrosine metabolism
    XALc_1049
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    XALc_1049
   00626 Naphthalene degradation
    XALc_1049
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     XALc_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178114..1179130
Genome map
AA seq 338 aa AA seqDB search
MKAAVVHKFGGPLEIEEVTVPQPGFGEILVKIEACGVCHTDLHAVHGDWPVKPTLPFIPG
HEGVGYIVALGPGVIHLKEGDRVGVPWLYSACGHCEHCLGGWETLCETQKNTGYSVNGAF
AEYALAAADYVGHLPDNVGFVEIAPVLCAGVTTYKGLKVTDTRPGQWVAISGIGGLGHMA
VQYAKAMGLKVAAVDVDDAKLDLARRLGAEITVNAKNIDPALFLKKEIGGVHGALVTAVS
PSAFSQAMNMVRRGGTVSLNGLPPGKFDLSIFDMVLNGVTVRGSIVGTRLDLQESLDIAK
DGKVVATVSRERLDNINDVFKRMREGNIEGRVVLDFAA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcggttgtccataaattcggtggcccactggaaatcgaggaggtaacggta
ccgcaaccggggtttggcgagatactagtgaagatcgaggcctgtggcgtgtgccacacc
gacttgcatgcggtgcatggcgactggccggtaaagcccacattgcccttcattccgggt
catgagggagtaggctacatcgttgcgctcgggcctggcgtcatccacttgaaagagggg
gaccgcgttggcgtgccttggctatactcggcttgcggtcattgcgagcattgtctgggc
ggctgggagacgctgtgcgaaacgcagaagaacaccggttactcggtcaacggcgctttt
gccgaatacgctctcgctgctgccgactacgtgggccatctgccggataacgtgggcttt
gtcgagatcgcgccggtgctgtgtgcgggcgtcactacatacaaggggttgaaggtcacc
gacacccggcctggccagtgggtagctatttccggcatcggaggcctgggccacatggca
gtgcagtacgcgaaggcgatgggactcaaagttgcagcggtggacgtcgacgatgccaag
ctagatctggcgcgtcggctcggcgcggagatcacggtcaacgcaaagaacatcgatcca
gcgctttttcttaagaaggaaatcggcggtgtgcacggcgcactggtgactgccgtttcg
cctagtgcattcagtcaggcgatgaacatggtgcgccgtggcgggaccgtgtcgcttaat
ggcctaccgcctggaaaattcgacctgtcgatcttcgacatggtgctcaacggagtcact
gtgcgcggttcgatcgtcggcacccgcctggatctacaggagtcgctggatatcgcgaag
gatggcaaagtggtggccacggtctctagagagagactggacaacatcaacgatgtattc
aaacgtatgcgtgaaggcaacatcgagggcagggtagtactggacttcgctgcctaa

DBGET integrated database retrieval system