KEGG   Xanthomonas albilineans: XALc_1124Help
Entry
XALc_1124         CDS       T01160                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xal  Xanthomonas albilineans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xal00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:xal00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319616..1320107
Genome map
AA seq 163 aa AA seqDB search
MEMQTTAYAFTATTLDGHVQPLVDYAGNVLLIVNVASKCGFTPQYAGLQALWERYRDRGL
VVLGFPCDQFGHQEPGNADEIRQFCSLSYGVDFPMFAKVQVNGENAHPLWRWLKQQKSGA
FGIAAIKWNFSKFLLDRKGQVLARYAPTTKPEALAVQIERALG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggagatgcagaccacggcttatgcctttactgcgacgaccctggatggccatgttcag
ccgctggtcgattacgccggcaatgtgctgctgatcgtcaatgttgcatccaaatgcggc
ttcactccgcaatatgcaggtctgcaggcgctgtgggagcggtaccgcgatcgtggcctg
gtggtactcggtttcccgtgcgatcagttcggtcatcaggaaccgggcaatgccgatgag
atccgccagttctgttcgttgagctacggtgtcgatttcccgatgttcgccaaggtgcag
gtcaatggcgagaatgcgcatccgttgtggcgctggctcaagcagcaaaagtcgggtgcg
ttcggaatcgcggcgatcaaatggaatttcagcaagtttctgcttgatcgcaaggggcag
gtgctggcgcgttatgcgcccaccaccaagccggaagcgctggccgtacagatcgagcgc
gcgttgggctga

DBGET integrated database retrieval system