KEGG   Xanthomonas albilineans: XALc_1129Help
Entry
XALc_1129         CDS       T01160                                 

Gene name
pldA
Definition
outer membrane phospholipase a protein (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
xal  Xanthomonas albilineans
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:xal00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:xal00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xal00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xal00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:xal00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1325075..1326226)
Genome map
AA seq 383 aa AA seqDB search
MPHRKAPHLLLLSIATVQLAHAQEFMPTPASPEACVAISNDAARLSCYDQALSRRVASPP
APDSPPQPPGKRQKQPLDTTLPKDTGVAKRTRPHANPPFQQDRYDSTIANAGNGSMLDSR
WELAQDSKLGTFQLRGYKPMYLLPAFWTSRKNTLPTSPNPFNTVTRAEQLDSMEVKFQLS
MKTKIAQNIFGDNGDLWATYTQSSRWQLYNARQSRPFRETDYEPELILAFRNDYSLFGWK
GRMSAIQLTHQSNGQSDPLSRSWNRAILNIGLDRDNWALILRPWYRLPETRKQDNNPDIE
DYMGRGDATLIYNHDGQELALMARHSLRGGDRAHGAVQLDWGFPISHLLRGHVQVFDGYG
ESMIDYNHRATYLGLGISLLEWF
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccgcaaggctccccacctgctgttactgtcgatcgcaaccgtgcagctggcg
cacgcacaagaattcatgcccacccccgcctcaccggaagcctgcgtcgccatttccaac
gatgccgcgcgcctgtcgtgttacgaccaagccttgtcgcgccgggtcgccagcccgcca
gcacccgactcgcccccccagcccccaggcaaacgccagaaacagccactggacaccaca
ttgccaaaggacactggagtcgccaaacgtacacgcccacacgccaacccaccgttccag
caggatcgttacgacagcaccatcgccaacgccggcaatggctcgatgctggacagccgc
tgggagctggcgcaagactccaagctaggcaccttccagctacgcggctacaagccgatg
tatctgctaccagcgttctggaccagcaggaaaaacacgctgcccacctcgccgaacccg
ttcaacacggtgacccgcgcggaacagctggacagcatggaagtgaaattccagctcagc
atgaaaaccaagatcgcgcagaacatcttcggcgacaacggcgacctgtgggcgacttac
acccagagttcgcgctggcagctctacaacgcccgacagtcgcggccgttccgcgaaacc
gactacgagccggaactgatcctggcgttccgcaacgactacagcctgttcggctggaag
ggccggatgagtgcgatccagttgacccatcagtccaacggtcagagcgatccgctgtcg
cgcagctggaaccgagcgatcctcaacatcggcctggatcgcgacaactgggcgctgatc
ctgcgcccgtggtaccggctcccggaaacccgcaagcaggacaacaacccggacatcgaa
gattacatgggccgcggcgacgcgaccttgatctacaaccatgacggccaggagttggcg
ctgatggcgcggcattcgctgcgcggcggcgaccgcgctcacggcgcggtgcaactggac
tggggctttccgatcagccacctgttacgcggtcatgtgcaggtgttcgacggctatggc
gaaagcatgatcgactacaaccatcgcgcgacttaccttggcctggggatttcgctactg
gaatggttctag

DBGET integrated database retrieval system