KEGG   Xanthomonas albilineans: XALc_1155Help
Entry
XALc_1155         CDS       T01160                                 

Gene name
truD
Definition
tRNA pseudouridine synthase d (tRNA-uridine isomerase d)(tRNA pseudouridylate synthase d) protein (EC:5.4.99.-)
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
xal  Xanthomonas albilineans
Brite
Enzymes [BR:xal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     XALc_1155 (truD)
Transfer RNA biogenesis [BR:xal03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    XALc_1155 (truD)
 Prokaryotic Type
    XALc_1155 (truD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1355367..1356434
Genome map
AA seq 355 aa AA seqDB search
MSALPRAFGVASLQARMRCAAEDFQVDEMPAFAPSGEGEHLLLRVRKRGMNTAFVVRRLA
QWAGVAEMAIGYAGMKDRHAVTTQRFSVHLPKRVAPALETLHDADLQVLETHWHNRKLPR
GALAGNAFILVLREVRGARAAIDARLAQIAARGIPNWFGEQRFGRDGGNVAAALAMFGGR
RVRREQRALLLSAARSELFNRVLSARVSAGNWDGPLDGEVWMLDGSRSVFGPEPWTEALA
ARLQCFDIHPSAPLWGSGALRSADAAQALELAALDDTLALRLREGLEREGLKQERRATRL
RVADLHWRWLEDGHDDVLELRFALPPCSYATALLHELGEVVDAGQTRDDSPAALP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcattgccgcgcgcgttcggcgtggcgtcgctgcaggcgcgcatgcgttgtgcg
gcggaagactttcaggttgacgaaatgcccgcattcgcgccgagcggcgagggcgagcac
ttgctgctgcgcgtgcgcaagcgcggcatgaacaccgcgtttgtcgtgcgccgcctggcg
cagtgggccggcgtggcagagatggcgatcggctatgcgggcatgaaggatcgtcatgcg
gtcaccacccagcgtttctcggtgcatttgcccaaacgcgtggctccagccctggagacg
ttgcacgatgccgacctgcaagtgctggaaacgcactggcacaatcgcaagttgccgcgt
ggcgcgctggccggcaatgcctttattttggtgttacgcgaagtgcgtggcgcgcgcgcc
gcgatcgatgcgcggctggcgcagattgccgcgcgcggcattcccaactggttcggcgag
cagcgcttcggccgcgacggtggcaacgtcgcggccgcgctggcaatgttcggcgggcgt
cgggtgcgtcgcgagcagcgtgcgctgctgctgtccgcggcgcgttcggaattgttcaat
cgggtgctgtcggcgcgcgtgagcgctggcaactgggatggcccgctcgacggcgaggtg
tggatgctcgatggcagtcgcagcgtgttcggtccggagccatggaccgaggcgctggcc
gcgcggttgcagtgcttcgatatccatccctcggcgccactgtggggaagcggcgcactg
cgcagcgccgatgcggcgcaagcactggaactggcggcattggacgatacgcttgcgctg
cgcctacgcgaagggctggaacgcgagggattgaaacaggaacggcgtgcgactcgttta
cgtgtggccgatctgcattggcgttggctggaggacgggcacgatgatgtgctggagttg
cgcttcgcactgccaccgtgcagttacgccacggcgctgctgcacgaactgggcgaggtc
gtcgacgccggccagacgcgcgacgactcgcccgctgcattgccgtga

DBGET integrated database retrieval system