KEGG   Xanthomonas albilineans: XALC_1165Help
Entry
XALC_1165         CDS       T01160                                 

Gene name
folP
Definition
(GenBank) probable dihydropteroate synthase, dhps protein (EC:2.5.1.15)
  KO
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
xal  Xanthomonas albilineans
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XALC_1165 (folP)
Enzymes [BR:xal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     XALC_1165 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1363992..1364894
Genome map
AA seq 300 aa AA seqDB search
MFDTSPRLDCAGRILTLDRPRVMGIVNVTPDSFSDGGTHTTVEAAVAHGLRLAEEGADLL
DIGGESTRPGATAVPVEEELRRVIPVIERLVAQTALPLSVDTFKPEVMRAAVAAGAGMIN
DVQALRQPGALDAVADLRVPVVLMHMPGDAYAAGSAPHYDDVVAEVHRFLVERIFAAEMA
GIDKRRLLIDPGFGFGKSTADNVQLLAHLPRLCELGVPVLAGLSRKRSIGELTGRELPEQ
RVAGSVAAHLLAAQRGALLLRVHDVAATVDALTVWQAVQAVPSPRVATGTAMPIRWPDED
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatacctcgcctcgcctggattgcgctggccgcatcctgacgctggaccgcccg
cgggtcatgggcatcgtcaacgttactcccgactcgttctccgatggcggcacgcatacg
acggtcgaagcggcggtcgcgcatggcctgcgtctggccgaggagggcgcggacctgctc
gatatcggtggcgaatcgacccggcctggtgccactgcggtgccggtggaggaagaactg
cgccgggtgattccggtgatcgagcgactggtcgcacagaccgcgctgccgctgagcgtg
gataccttcaagccggaggtgatgcgcgcggcggtggcggccggtgccggcatgatcaac
gacgtgcaggcgctgcgtcagcccggtgcgctggatgcggtcgcggacctgcgcgtgccg
gtggtgctgatgcatatgcccggcgacgcctacgccgctggcagtgcgccgcactacgac
gacgtggtcgccgaggtgcatcgatttctggtcgagcgtattttcgctgcggagatggcc
ggcatcgacaagcgccgcttgctgatcgatccgggcttcgggttcggcaagagcaccgcc
gacaatgtgcagttgcttgcgcatctgccgcgtctgtgcgagttgggcgtcccggtgctg
gcgggcttgtcgcgtaagcgcagcatcggcgagttgaccggacgcgagttgccggaacag
cgcgtggccggttctgtcgccgcacacttgctggccgcgcagcgcggcgcattgctgctg
cgtgtgcatgacgtcgccgcgaccgttgacgcactgacggtctggcaggcggtacaggct
gtgccgtcgccgcgtgttgcgacggggacggcaatgccgatccgctggccggacgaggac
tga

DBGET integrated database retrieval system