KEGG   Xanthomonas albilineans: XALc_1196Help
Entry
XALc_1196         CDS       T01160                                 

Gene name
xylA1
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
xal  Xanthomonas albilineans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XALc_1196 (xylA1)
   00051 Fructose and mannose metabolism
    XALc_1196 (xylA1)
Enzymes [BR:xal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     XALc_1196 (xylA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398646..1399986
Genome map
AA seq 446 aa AA seqDB search
MSNSVYIGAKEYFPGIGRIPFEGKASDNPLAFKVYDADKQLGGKSMAEHLRFAVAYWHSF
CGNGADPFGPGTRAYPWDAGSDALARAEAKADAAFEFFTKLGVPYYCFHDVDLAPDAEAI
GQYEKNLQHMVGIAKQRQADTGIKLLWGTANLFSHPRYMNGAATNPDFDVVARAAVQVKA
ALEATVALGGENYVFWGGREGYACLHNTQMRREQEHLARFLTLARDYGRSIGFKGNFLIE
PKPMEPMKHQYDFDSATVVGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPVDLYDTVGAMLVVLRQGGLAPGGLNFDAKVRRESSDPQDL
FVAHIGGMDAFARGLEVAHALLTSSPLEQWRKARYASFDSGAGAAFAAGKSTLAELAAHA
GKVGEPTQRSGRQEAYENLINQYLLR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattccgtctatatcggcgccaaggaatattttccgggcatcggccgcattccg
ttcgaaggcaaagcctcggacaacccgctggcgttcaaggtctacgacgccgataagcaa
ctcggcggcaaatccatggctgagcacctgcgttttgccgtggcgtattggcacagtttc
tgcggcaacggcgccgatccgttcggtccgggcacgcgcgcctatccgtgggatgccggt
agcgacgcactggcgcgggccgaggccaaggccgatgcggcattcgaatttttcaccaaa
ctcggcgtgccgtattactgcttccacgatgtggatctggccccggacgcggaggccatc
ggccagtacgagaagaacctgcagcacatggtcggtattgccaagcagcgccaggccgac
accggcatcaagttgctgtggggcacggccaacctgttctcgcatccgcgctatatgaac
ggcgcggcgaccaacccggatttcgacgtggtggcgcgcgcggcggtgcaggtcaaggcg
gcgttggaagcgacggtggccttgggcggggagaactacgtgttctggggcggtcgcgag
ggctatgcgtgcctgcacaacacgcagatgcggcgcgagcaggagcatttggcgcgcttc
ctcactctggcgcgcgactacggacgcagcatcggcttcaagggcaatttcctgatcgag
cccaagccgatggagccgatgaagcaccagtacgatttcgacagcgccacggtggtgggt
tttctgcgccagcacgggctggatcaggatttcaagctcaacatcgaggccaaccacgcc
acgttgtccgggcacagtttcgagcacgatctgcaggtggccagcgatgcgggcctgctg
ggcagcatcgacgccaaccgcggcaatccgcagaacggctgggacaccgaccagttcccg
gtggatctgtacgacacggtgggggcgatgctggtggtgctgcggcagggcggcctagcg
ccgggcgggttgaacttcgatgcgaaggtgcggcgcgaatcctccgatccgcaggacctg
ttcgtggcgcacatcggcgggatggacgcgttcgcgcgcgggctggaagtggcgcacgcg
ctgctgacgtcctcgccgctggaacagtggcgcaaggcgcgctacgcgagtttcgacagc
ggtgcgggggcggccttcgcggcgggcaagagcacgctggcggagctggccgcgcatgcg
ggcaaggtcggcgaaccgacgcaacgcagtggccgccaggaagcctacgagaacctgatc
aaccagtatctgctgcgctga

DBGET integrated database retrieval system