KEGG   Xanthomonas albilineans: XALc_1204Help
Entry
XALc_1204         CDS       T01160                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, hppk; protein (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
xal  Xanthomonas albilineans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XALc_1204 (folK)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     XALc_1204 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1407515..1407928
Genome map
AA seq 137 aa AA seqDB search
MDTLPQTRLLCASQLYRSPAWGNQAQPDFINAAALVSTGLSASALLQALLALETRHGRQR
HPAERWGPRTLDLDLLLYAEAVIDLPGLQVPHPFLHARGFALLPLAEIAAGATIPGHGTV
REACERIDTSAIVPIGR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttggacacgctgccgcaaacgcgcctgctatgtgcctcgcagttgtaccgaagcccagcc
tggggcaatcaggcgcagccggatttcatcaatgccgccgcgctggtgtcaaccgggcta
tcggcttcggcgttattgcaggctctgcttgcgttggaaacccggcatggccggcagcgc
catccggccgagcgctgggggccgcgtaccctggacttggatctgttgctgtacgctgag
gcggtgatcgaccttcctgggctgcaggtgccgcatccgttcctgcacgcgcgtggtttc
gcgctgctgccgctggccgagatcgctgccggggcgacgattcccggccatggcacggtg
cgcgaagcatgcgagcgcatcgacaccagcgcaatcgtgccaatcggtagataa

DBGET integrated database retrieval system