KEGG   Xanthomonas albilineans: XALc_1246Help
Entry
XALc_1246         CDS       T01160                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
xal  Xanthomonas albilineans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    XALc_1246 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    XALc_1246 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    XALc_1246 (thrC)
Enzymes [BR:xal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     XALc_1246 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449437..1450738
Genome map
AA seq 433 aa AA seqDB search
MNFISTRNTAPAVSLSQAIAAGLAPDGGLYVPERLPPARALTPGARLAETAAVLLAPFFE
GDALEPELPALCAEAFDFAAPLQPLVTPGDHALELFHGPTAAFKDFGARFLAACLTRLRR
DTATPLTILVATSGDTGAAVAAAFHRQPGLRVVVLYPDGRVSPRQAHQLGCFGDNIQALR
VAGSFDDCQALVKQALNDATLQAQVPLSSANSISLGRLLPQMSYYAHAALTHHAAHAQSL
NLVVPTGNLGNALAAILARGLGVPLGQIVLATNANRVLPEYFAGAAYAAQSSIATLANAM
DVGAPSNFERLRWLYRSDDASLRTQFRAYSVDDARIRQVIGERFRRYGEVHCPHTATALH
VLQQLRAEAAQADAGDWAVVATAHPAKFEAVVEPLIGQPVPVPAALAELLQRYAYAEPIA
ADYAGLRARLLAG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcatttccacccgtaacaccgcgccggccgtttcgctcagccaagccatcgct
gccggtctggcgcccgatggcggcctttacgtccctgagcgcctgccgccagcacgggct
ttgacgcccggcgctcgcctggccgagaccgccgcagtgttgctggcgccgttttttgag
ggcgatgcgctggagccggaattgccggcgctttgcgccgaggcgttcgatttcgctgcg
ccgctgcaaccgctggtcacgccgggcgatcacgccttggagttgttccatgggccgacc
gccgcgttcaaggacttcggagcgcgcttccttgccgcctgcctgacgcgattgcggcgc
gacacggcgacgccgttgaccatcctggtcgctacctccggcgataccggcgccgcggtc
gctgccgcgttccatcgccagcctggcttgcgcgtggtggtgttgtatccggatggccgc
gtgtcaccgcggcaggcgcaccagttgggctgtttcggcgacaacatccaggccctgcgc
gtggccggttcgttcgatgactgccaggcgttggtcaagcaggccctcaacgatgccacg
ctgcaggcgcaggtaccgctgagttcggccaacagcatcagcctggggcggctgttgccg
cagatgagctattacgcgcatgcggcgctgactcatcacgccgcgcatgcgcagtctctg
aatctagtggtgccgaccggcaatctgggcaatgcgctggcggcgattctggcgcgcgga
ttgggtgtgccgttgggccagatcgtgctggcaaccaacgccaatcgtgtactgccggag
tatttcgcgggcgcggcatacgcggcgcagtccagcatcgccacgctagccaatgcgatg
gatgtcggcgcaccaagcaatttcgaacgcttgcggtggttgtatcgcagcgacgatgcg
tcgctgcgcacgcagttccgggcgtattcggtggacgatgcgcggatccgtcaggtgatc
ggcgagcgcttccggcgctatggcgaagtgcattgtccgcacaccgcgacggccttgcac
gtgctgcagcagttgcgtgccgaggcggcgcaggccgatgctggcgattgggcggtggtg
gcgaccgcgcatccggccaaattcgaggcggttgtggagccattgattggacagccggtg
ccggtgccagcggcattggccgagttgttgcagcgctatgcctatgccgagccgattgca
gcggactatgccggcttgcgcgctcgcttgctggctgggtga

DBGET integrated database retrieval system