KEGG   Xanthomonas albilineans: XALC_1321Help
Entry
XALC_1321         CDS       T01160                                 

Definition
(GenBank) putative acireductone dioxygenase family oxidoreductase protein
  KO
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xal  Xanthomonas albilineans
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    XALC_1321
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     XALC_1321
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     XALC_1321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1527932..1528498)
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFANTTPEAPLFDSRDGDAIATELQKIGVVFERWQASQPIQAGASPEAVMAAYRA
DIDRLVAAHNFKTVDVVSIAPDHPQREEMRKKFLDEHFHKEDEVRFFVAGSGLFTLHVDG
KVYEIECVQNDLIAVPDGTRHWFDMGPEPRFVAIRFFTEPDGWIGHFTGTDIAQRFPRYE
PAQRGEAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactccgcatcttcgccaacaccactcccgaggcgccactgttcgacagccgc
gatggcgatgcgatcgccaccgagttgcagaaaatcggcgtcgtcttcgagcgctggcag
gccagccagccgatccaggccggcgcctcgcccgaagccgtgatggccgcctaccgcgcc
gacatcgaccgcctggtggccgcgcacaacttcaagaccgtggacgtggtcagcatcgcc
cccgaccatccgcagcgcgaggagatgcgcaagaagtttctcgacgaacatttccacaag
gaagacgaggtgcgcttcttcgtcgccggctccggactcttcacactacacgtggacggc
aaggtctacgagatcgaatgcgtgcaaaacgatctgatcgcggtgcccgacggcacgcgc
cactggttcgacatgggcccggagccacgcttcgtcgcgatccgcttcttcaccgagccc
gacggctggatcggccacttcaccggcaccgacatcgcccagcgcttcccgcgctacgag
ccagcccagcgcggcgaggcgcactga

DBGET integrated database retrieval system