KEGG   Xanthomonas albilineans: XALC_1321Help
Entry
XALC_1321         CDS       T01160                                 

Definition
(GenBank) putative acireductone dioxygenase family oxidoreductase protein
  KO
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
xal  Xanthomonas albilineans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1527932..1528498)
Genome map
AA seq 188 aa AA seqDB search
MSRLRIFANTTPEAPLFDSRDGDAIATELQKIGVVFERWQASQPIQAGASPEAVMAAYRA
DIDRLVAAHNFKTVDVVSIAPDHPQREEMRKKFLDEHFHKEDEVRFFVAGSGLFTLHVDG
KVYEIECVQNDLIAVPDGTRHWFDMGPEPRFVAIRFFTEPDGWIGHFTGTDIAQRFPRYE
PAQRGEAH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagccgactccgcatcttcgccaacaccactcccgaggcgccactgttcgacagccgc
gatggcgatgcgatcgccaccgagttgcagaaaatcggcgtcgtcttcgagcgctggcag
gccagccagccgatccaggccggcgcctcgcccgaagccgtgatggccgcctaccgcgcc
gacatcgaccgcctggtggccgcgcacaacttcaagaccgtggacgtggtcagcatcgcc
cccgaccatccgcagcgcgaggagatgcgcaagaagtttctcgacgaacatttccacaag
gaagacgaggtgcgcttcttcgtcgccggctccggactcttcacactacacgtggacggc
aaggtctacgagatcgaatgcgtgcaaaacgatctgatcgcggtgcccgacggcacgcgc
cactggttcgacatgggcccggagccacgcttcgtcgcgatccgcttcttcaccgagccc
gacggctggatcggccacttcaccggcaccgacatcgcccagcgcttcccgcgctacgag
ccagcccagcgcggcgaggcgcactga

DBGET integrated database retrieval system