KEGG   Xanthomonas albilineans: XALc_1467Help
Entry
XALc_1467         CDS       T01160                                 

Definition
cytochrome C precursor
Orthology
K08738  
cytochrome c
Organism
xal  Xanthomonas albilineans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    XALc_1467
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    XALc_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1692717..1693115)
Genome map
AA seq 132 aa AA seqDB search
MKPVNTFPLWRTLIVSLLPLSLALVPAAHAAGDLPGKGVFASECAECHSATAGKNKKGPS
LFGVAGRRAGSVPDFNYSDAMKQSQWTWSDEKLHSYLSQPASKAMPGTKMKYDGLDDDKQ
LQELITYLHSLH
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtcaacaccttcccgctgtggcgcaccctgatcgtcagtctgttgccgctg
agccttgcccttgtacccgccgcacatgccgccggcgacctgcccggtaaaggcgtgttc
gccagcgagtgcgccgaatgccacagcgccacggcaggcaagaacaagaaaggccccagc
ctgttcggagtcgccggacgccgtgccggcagcgtgccggacttcaactactcagacgcc
atgaagcagagccagtggacctggagcgacgagaagctgcacagctacttgtcacagccg
gcgtccaaggcaatgcccgggaccaagatgaagtacgacggactcgacgacgacaaacaa
ttgcaagagttgatcacctatctccacagcctgcattga

DBGET integrated database retrieval system