KEGG   Xanthomonas albilineans: XALc_1596Help
Entry
XALc_1596         CDS       T01160                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
xal  Xanthomonas albilineans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    XALc_1596 (galU)
   00052 Galactose metabolism
    XALc_1596 (galU)
   00500 Starch and sucrose metabolism
    XALc_1596 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    XALc_1596 (galU)
Enzymes [BR:xal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     XALc_1596 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886334..1887215)
Genome map
AA seq 293 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLIFVTNR
YKHAVADYFDKAYELEQKLERAGKHEQLEMIRHVLPDGVRAIFVTQAEALGLGHAVLCAK
SVVGDEPFAVLLPDDLIWNRGDGALKQMADLNAASGASVIAVEDVPHENTASYGIVATDA
FDGRNGRIKQIVEKPKPADAPSDLAVVGRYVLSPKIFELLEGTGTGAGGEIQLTDAIATL
LKSERVDAYRFEGTRFDCGTHLGLVEATIRFALENKKLAKPAREKLTQMLAED
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagaatccgcaaggcagtattcccggtcgcaggtctgggtacccgtttcctt
cccgccaccaagaccgtacccaaagaaatgctgccgatcatcgatcggccgttgatccag
tatgccgtggacgaggcgatcgaggccgggtgcgataccttgatcttcgtgaccaatcgc
tacaagcatgcggtcgcggattatttcgacaaggcctacgaactagagcaaaagctagag
cgggctggcaagcacgaacagttggagatgatccgtcatgtgctgcccgatggcgtgcgc
gcgatcttcgttacccaggcggaagccttgggcctggggcatgcggtactgtgcgccaag
tcggtggttggcgacgagccattcgcggtgctgctgccggacgatctgatctggaaccga
ggcgacggcgccctcaagcagatggccgatctcaacgccgctagcggcgccagcgtgatt
gccgtggaggacgtgccgcatgagaacaccgccagctatggcatcgtggctacggatgct
ttcgatggccgcaatggccgcatcaaacagatcgtggaaaagccgaaaccggcagacgcg
ccgagcgatctggccgtggtggggcgttacgtactcagcccgaagatcttcgaactgttg
gaaggtaccgggactggcgccggtggcgagatccagctcaccgacgcgatcgcgacgctg
ttgaagagcgaacgagtcgacgcctatcgtttcgaagggacccgtttcgattgtggtact
cacctgggtctggtcgaagcgaccattcgtttcgcgttggaaaacaagaaacttgccaag
ccggcgcgcgagaagctcacccagatgcttgcggaagattaa

DBGET integrated database retrieval system