KEGG   Xanthomonas albilineans: XALc_1641Help
Entry
XALc_1641         CDS       T01160                                 

Gene name
bdhA
Definition
3-hydroxybutyrate dehydrogenase precursor (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xal  Xanthomonas albilineans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    XALc_1641 (bdhA)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    XALc_1641 (bdhA)
Enzymes [BR:xal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     XALc_1641 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1940682..1941440
Genome map
AA seq 252 aa AA seqDB search
MQTVLITGAASGIGAGIARELAASDRHIVVSDLDAAAAVAVATQLRQAGGSAESVALDVG
SAASIEAALATLSRPVDVLVNNAGLQHVAPLQDFPMDRWSLLVEVMLTGVARLTQAVLPG
MRARGFGRIVNIGSIHSLVASPYKSAYVAAKHGLVGFSKVIALETADTDITINTLCPSYV
KTPLVDKQIADQARTRGISAADVIAQVMLKPMPKGVFIDYDELAGCVAFLASPAARNITA
QTIAIDGGWIAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgtcctgatcaccggcgccgccagcggcatcggcgcgggcatcgcccgtgaa
ctcgccgccagtgaccgtcacatcgtggtcagcgacctcgacgctgccgccgccgtcgca
gtggccacgcaattgcgtcaggccggcggttcggccgagtcggtggcgttagacgtcggc
agcgcggccagcatcgaggcagccctggccacgttgtcgcgcccggtggacgtgctggtc
aacaatgccggtttgcagcacgtggcacccttgcaggattttccgatggacagatggagc
ctgcttgtggaagtgatgctgaccggcgtggcacgactgactcaggcggtgttgccaggc
atgcgcgcacgcggtttcggccgcatcgtcaatatcggcagcatccactcgttggtcgcc
agcccctacaagagcgcctatgtcgcggccaagcacgggctggtcggattctccaaggtg
atcgcactggaaaccgccgataccgacatcaccatcaacacgctctgccccagctacgtc
aaaacgccgctggtggacaagcagatcgccgaccaagcccgcactcgtggcatttccgca
gcggacgtgatcgcacaggtaatgctcaagccgatgcccaagggggtgttcatcgactat
gacgaattggctggctgcgtggcgttcctcgcctcccctgccgcgcgcaacattaccgcg
cagaccatcgccatcgatggcggctggatcgcgcagtaa

DBGET integrated database retrieval system