KEGG   Xanthomonas albilineans: XALc_1669Help
Entry
XALc_1669         CDS       T01160                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xal  Xanthomonas albilineans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    XALc_1669 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XALc_1669 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XALc_1669 (sucB)
Enzymes [BR:xal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XALc_1669 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968882..1970096
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGDAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FETGASVTSSQILAIIEEGASAAASPAAAKDAAAPTPSAPKAAAAETPKAAKVETPKASG
DVSSLPPGARFSAITEGVDPAQVEGTGRRGAVTKEDILNYAKNGGAGKASGARPEERVPM
TRVRKRIAERLMQSKNSTAMLTTFNEVNLAKVSAARKELQDEFQKVHGIKLGFMSFFVKA
AANALQRFPLVNASIDGEDIIYHGYSDISIAVSTDKGLVTPVLRNVERLSFADIEQGIAD
YAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtatccgatgccaccatcgcc
agctggcacaaaaaagccggcgacgcggtcaagcgcgacgagaatctggtggacctggaa
accgacaaggtcgtgctggaagtgccctcgcccgtcgatggcgtgttgaaggaaatcaag
ttcgagactggcgccagcgtgaccagttcgcagatcttggcgatcatcgaggaaggcgcg
agcgccgctgcgtccccggccgcagccaaggacgccgccgcaccgacgccgagtgcgccc
aaagccgccgctgcggaaacacccaaggcagccaaggtggaaacaccgaaagcctccggc
gacgtgtccagcctgccgccgggcgcgcgcttcagcgcgatcaccgagggcgtggatccg
gcacaggtcgaaggcaccggccgccgtggcgcagtgaccaaggaagatatcctcaattac
gcaaagaacggcggtgccggcaaagcatccggcgcgcgtccggaagagcgcgtgccgatg
acccgcgtgcgtaaacgcatcgccgagcgcctgatgcagtcgaagaactcgaccgcgatg
ctgaccaccttcaacgaggtcaacctggccaaggtttcggccgcgcgcaaggaactgcag
gacgagttccagaaggtccacggcatcaagctcggcttcatgagcttcttcgtcaaggcc
gcagccaacgcgctgcagcgtttcccgttggtcaacgcctcgatcgacggcgaggacatc
atctatcacggttacagcgacatctccatcgccgtgtccaccgacaagggtctggtgacg
ccggtactgcgcaatgtcgagcgcctgtcctttgccgacatcgaacagggcatcgccgat
tacgccaagaaagcgcgcgacggcaagctgagcctggaagaactacagggcggcaccttc
accgtgaccaacggcggcaccttcggctcgctgctgtcgaccccgatcatcaatccgcca
cagagcgcgatcctgggcatgcacgcgatcaaggagcgtccgatcgccgagaacggtcag
gtcgtgatcgcgccaatgatgtatctggcactgtcctacgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtagacatcaagaatcagctggaaaaccctggccggatg
ctgttcggcctataa

DBGET integrated database retrieval system