KEGG   Xanthomonas albilineans: XALC_1669Help
Entry
XALC_1669         CDS       T01160                                 

Gene name
sucB
Definition
(GenBank) probable dihydrolipoamide succinyltransferase protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
xal  Xanthomonas albilineans
Pathway
xal00020  Citrate cycle (TCA cycle)
xal00310  Lysine degradation
xal01100  Metabolic pathways
xal01110  Biosynthesis of secondary metabolites
xal01120  Microbial metabolism in diverse environments
xal01130  Biosynthesis of antibiotics
xal01200  Carbon metabolism
Module
xal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:xal00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    XALC_1669 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    XALC_1669 (sucB)
Enzymes [BR:xal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     XALC_1669 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: CBA16166
UniProt: D2UDU4
Position
1968882..1970096
Genome map
AA seq 404 aa AA seqDB search
MATEVKVPVLPESVSDATIASWHKKAGDAVKRDENLVDLETDKVVLEVPSPVDGVLKEIK
FETGASVTSSQILAIIEEGASAAASPAAAKDAAAPTPSAPKAAAAETPKAAKVETPKASG
DVSSLPPGARFSAITEGVDPAQVEGTGRRGAVTKEDILNYAKNGGAGKASGARPEERVPM
TRVRKRIAERLMQSKNSTAMLTTFNEVNLAKVSAARKELQDEFQKVHGIKLGFMSFFVKA
AANALQRFPLVNASIDGEDIIYHGYSDISIAVSTDKGLVTPVLRNVERLSFADIEQGIAD
YAKKARDGKLSLEELQGGTFTVTNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAENGQ
VVIAPMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagttccggtactgcccgaatccgtatccgatgccaccatcgcc
agctggcacaaaaaagccggcgacgcggtcaagcgcgacgagaatctggtggacctggaa
accgacaaggtcgtgctggaagtgccctcgcccgtcgatggcgtgttgaaggaaatcaag
ttcgagactggcgccagcgtgaccagttcgcagatcttggcgatcatcgaggaaggcgcg
agcgccgctgcgtccccggccgcagccaaggacgccgccgcaccgacgccgagtgcgccc
aaagccgccgctgcggaaacacccaaggcagccaaggtggaaacaccgaaagcctccggc
gacgtgtccagcctgccgccgggcgcgcgcttcagcgcgatcaccgagggcgtggatccg
gcacaggtcgaaggcaccggccgccgtggcgcagtgaccaaggaagatatcctcaattac
gcaaagaacggcggtgccggcaaagcatccggcgcgcgtccggaagagcgcgtgccgatg
acccgcgtgcgtaaacgcatcgccgagcgcctgatgcagtcgaagaactcgaccgcgatg
ctgaccaccttcaacgaggtcaacctggccaaggtttcggccgcgcgcaaggaactgcag
gacgagttccagaaggtccacggcatcaagctcggcttcatgagcttcttcgtcaaggcc
gcagccaacgcgctgcagcgtttcccgttggtcaacgcctcgatcgacggcgaggacatc
atctatcacggttacagcgacatctccatcgccgtgtccaccgacaagggtctggtgacg
ccggtactgcgcaatgtcgagcgcctgtcctttgccgacatcgaacagggcatcgccgat
tacgccaagaaagcgcgcgacggcaagctgagcctggaagaactacagggcggcaccttc
accgtgaccaacggcggcaccttcggctcgctgctgtcgaccccgatcatcaatccgcca
cagagcgcgatcctgggcatgcacgcgatcaaggagcgtccgatcgccgagaacggtcag
gtcgtgatcgcgccaatgatgtatctggcactgtcctacgaccaccgcatcatcgacggc
aaggattcggtgcagttcctggtagacatcaagaatcagctggaaaaccctggccggatg
ctgttcggcctataa

DBGET integrated database retrieval system