KEGG   Xanthomonas albilineans: XALC_1776Help
Entry
XALC_1776         CDS       T01160                                 

Definition
(GenBank) putative esterase/lipase/thioesterase protein
  KO
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
xal  Xanthomonas albilineans
Brite
Enzymes [BR:xal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     XALC_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2092633..2093463
Genome map
AA seq 276 aa AA seqDB search
MTQSAEFHFEGGRHGVLLIHGLTGTPSEMRLLGKSLQRHGFSVHGVQLAGHCGDEDDLLA
TGWRDWYASVEQAAARMRPQVDSLFVAGLSMGALLALRLAVERPQWVDGVGVLGATFRYD
GWNIPKRARLAFILPLLKRLGIGKRRIFLEEPPYGLRDERIRAQVSSAMLGGDSSAAGLP
GNPWYALAELHLLSRQVRRNLAKVKAPCLVAHATDDDIAHLRNARLVIDNVSGPTELLLL
HDSYHMITLDRERRTLGTRLAQFFAALAAAAPRQAA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatctgcggaatttcacttcgaaggcggccgtcacggcgtgctgctgatccac
ggcctgaccgggactccaagcgaaatgcgcctgcttggcaagagcctgcaacgccatggt
ttcagcgtacacggcgtacagctggccgggcattgcggcgacgaggacgatctactcgct
accggctggcgcgattggtacgccagcgtcgaacaggccgccgcacgcatgcgtccacag
gtggacagcctgttcgtcgcggggctatcgatgggtgcactgctggccttgcggctggcg
gtcgagcgaccgcagtgggtggacggtgtcggcgtgctcggcgccaccttccgctacgac
ggctggaacattcccaagcgcgcgcggctagcgttcatattgccgctgctcaaacgcctg
ggcatcggcaaacgccgcatattcttggaagaaccgccttacggcctacgcgacgaacgt
attcgcgcccaagtcagcagcgccatgctcggtggcgatagcagtgccgccggtctgccc
ggcaatccgtggtatgcgctggccgaacttcatctgctctcgcgccaggtgcggcgcaat
ctggccaaggtcaaggcaccttgcctggtcgcacacgccaccgatgacgacatcgcccat
ctacgcaacgcgcgactggtgatcgacaacgtctccgggccgacggagttgctgctgcta
cacgacagctaccacatgatcacgctggatcgggaacgacgcacgctcggtacccgcttg
gcacagttcttcgccgcactggcggccgccgcaccgcggcaggccgcctga

DBGET integrated database retrieval system